KEGG   Bacillus thuringiensis HD-771: BTG_15380Help
Entry
BTG_15380         CDS       T02293                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTG_15380
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BTG_15380
Enzymes [BR:bti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BTG_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2983481..2984758)
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagaaagctgggaattagatgagcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatt
gaacatacattagcgcgccgcggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaatcaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtggcagctgatgcaaacctttctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtgaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcaacatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtggacaattaaacgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggtggaaaagtactactaccaacgcaaacagcg
gtacgtaatttaatttctgcacgtcttgcagcagatgtaatgggagtgccaacaattatc
gttgcaagaacagatgcagatgcagctgatttaattacgagcgatatcgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacgaatgcaggtctt
gatcaagcgattgcgcgcggtttagcgtatgcaccgtatgcagacctcgtttggtgtgaa
acgtcggaaccaaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccaggaaagttacttgcatataactgttcaccttcattcaactggaaacaaaaactagat
gaaaaaacaattgcgagcttccaaaaggaaatcgcatcttacggttataagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagctgaatttgcagcagaaaaa
cacggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtt
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacagaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system