KEGG   Bacillus thuringiensis HD-771: BTG_15595Help
Entry
BTG_15595         CDS       T02293                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00860  Porphyrin and chlorophyll metabolism
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTG_15595
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BTG_15595
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BTG_15595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 HI0933_like Pyr_redox_3 Thi4 DUF4988 DUF4136
Motif
Other DBs
NCBI-ProteinID: AFQ16567
UniProt: J3X011
Position
complement(3023189..3024610)
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIVGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAKPKKGIFQTVKTGLESIVESLEVKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PATSVANVALAFQKSAIRRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMQKELPGIYLAGSSYAGAGLPDCINQGEEAAKRVLSHLEKVIDAELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtgatcgtcggcggaggcataacgggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggttttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgcctcggaaacgaa
gtggttgaaaacttaatagaaccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcagattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctaaaccgaaaaaaggaatc
ttccaaacagtgaaaacaggtttagaatctatcgtagaatctctcgaagtaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcaaaacagggtgatggttat
acgattactcttagtaacggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccggccacatccgttgcgaatgtggcacttgctttccaaaagtcagcaatccggcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacacgattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaagaaaaacgatggatattacagaggatccagaatttacaatcgta
agccgctggaaagaagcgatgcctcaatatacagtaggccataatgagcgaatgaaaaag
ctcacaacatttatgcagaaagagttgcctggtatatacttggcaggtagctcctatgct
ggtgctggacttccagattgtattaatcaaggtgaggaagctgcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcgcacaataa

DBGET integrated database retrieval system