KEGG   Bacillus thuringiensis HD-771: BTG_21960Help
Entry
BTG_21960         CDS       T02293                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BTG_21960
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTG_21960
Enzymes [BR:bti01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BTG_21960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4352651..4353955
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDSSKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataatcaagtaacaatcgattcttctaaagaacta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
ccattattagcacgtaatggtcgtgctcgtattgcacttcctggtggatgtgcaatcggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatatgttgagggagaactaaaaggagctaaaatctactta
gacttcccaagcgtaggcgcgacagaaaacattatgtctgcagctacattagcaaaaggg
acaacaattcttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcaatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtt
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcagcaattactggtggagacatcttaattgaaaatgctgtacctgaacat
ttacgctcaattacagcgaaaatggaagaaatgggtgttaaaattattgaggaaaacgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatgga
acaagcatgattacagaaacggtattcgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaattgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtaggcgcaactgatttacgtgctgcagctgcattaatcttagct
ggtttagtatcagaaggttatactcgtgtaactgagttaaaacatcttgaccgtggttat
gtagatttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcacgcttaa

DBGET integrated database retrieval system