KEGG   Bacillus thuringiensis HD-771: BTG_22030Help
Entry
BTG_22030         CDS       T02293                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00040  Pentose and glucuronate interconversions
bti00052  Galactose metabolism
bti00500  Starch and sucrose metabolism
bti00520  Amino sugar and nucleotide sugar metabolism
bti01100  Metabolic pathways
bti01130  Biosynthesis of antibiotics
Module
bti_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTG_22030
   00052 Galactose metabolism
    BTG_22030
   00500 Starch and sucrose metabolism
    BTG_22030
   00520 Amino sugar and nucleotide sugar metabolism
    BTG_22030
Enzymes [BR:bti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTG_22030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AFQ17822
UniProt: J3X2L5
Position
4365804..4366682
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQNLLEKGKYEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMNQYEGTQSSVIGVQTVPENETHRYGIIDPIERNGR
SYQVRQFVEKPAEGTAPSDLAIMGRYVLTPEIFMFLEDQQTGAGGEIQLTDAIQRLNEMQ
RVFAYDFEGTRYDVGEKFGFIRTTIEMALQQKELKEQLIKYMVELVHKEAIK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaggcgataattccagctgctggtcttgggacaaggtttttgcca
gcaacgaaagcgatgccgaaagaaatgctacctatcgttgataaaccaacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaaggt
aaacgtgctattgaggatcattttgatcactcttttgaattagaacaaaaccttttggaa
aaaggcaagtatgaaatgcttgaaaaagtgcaagcatcttcaaaaattaatattcactac
ataaggcaaaaagaaccaaaaggacttggacatgcagtatggtgtgctcgtaaatttatt
ggaaatgaaccgtttgcggtattacttggtgatgatattgtgcaggcagaaacaccatgc
ttgcgtcaattaatgaatcaatatgaaggtacacaatcatctgtaattggtgtacaaaca
gtgccagaaaatgaaacacaccgttacggcattatcgatccaattgagcgaaatggccgc
agttatcaagtgcgtcaatttgtagaaaaaccagcagaaggaacagcaccatccgattta
gcaattatgggtcgttacgtattaacaccggaaatatttatgtttcttgaagatcaacag
acaggtgctggtggagaaattcagttgacagatgcgattcagcgtttaaatgaaatgcaa
cgtgtgtttgcgtatgactttgaaggtactcgttatgatgttggggaaaagtttgggttt
attaggactacaattgaaatggcactgcaacaaaaagaattaaaagaacaactcataaaa
tatatggttgaactagtacataaagaagcgatcaaataa

DBGET integrated database retrieval system