KEGG   Bacillus thuringiensis HD-771: BTG_23085Help
Entry
BTG_23085         CDS       T02293                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bti  Bacillus thuringiensis HD-771
Brite
Enzymes [BR:bti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BTG_23085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4558028..4558768
Genome map
AA seq 246 aa AA seqDB search
MKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEEL
VHTGPTDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMYI
KSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFQKTPMNTLKALQQLIADVRNNVDMI
YAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYNF
LEQLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgttttatta
ctacatggattcacagggaactcagctgatgtacgtatgttagggcgtttcttagaaaag
aaaggctatacttgtcatgcgccaatttataaagggcacggtgtaccaccagaagagctt
gttcatacaggccctacagattggtggcaagatgtaacggaggcatatcagcttttaaaa
gataaaggttttgagaaaattgctgttgttggattgtcacttggcggcgtattttcttta
aaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccgatgtatatt
aagagcgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaaacgt
gagcaaaaatcaccagaacaaattgaacaagaaatgttggaattccaaaagacaccgatg
aatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggatatgatt
tatgcaccaacatttgttgtacaagcacgtcatgacgaaatgattaatacagatagtgct
aacattatttataacggtgtagaatctacgttaaaagacattaaatggtatgaagactct
acgcatgtcattacacttgataaacaacgtgatgagctacatgaggatgtatataacttc
ttggagcaactagattggtaa

DBGET integrated database retrieval system