KEGG   Bacillus thuringiensis HD-771: BTG_25085Help
Entry
BTG_25085         CDS       T02293                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BTG_25085
Enzymes [BR:bti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BTG_25085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4915782..4916585
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVVT
GPSAPLQFAAKILNVLAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRMWFDNVKIGDKAYKEWPNCYHELLN
EYERDEILNYIQSFTEIHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcaaaagctgtcattgttatcgtgcacggcgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcacatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaagagagaagatgtagatggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgctgcaaaaatattaaatgttttggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacaaggaatcatgaagtgagagatgca
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagacgattttccagacgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcatgtggtttgataat
gttaaaataggtgataaggcatataaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system