KEGG   Bacillus thuringiensis HD-771: BTG_25085Help
Entry
BTG_25085         CDS       T02293                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bti00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4915782..4916585
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVVT
GPSAPLQFAAKILNVLAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRMWFDNVKIGDKAYKEWPNCYHELLN
EYERDEILNYIQSFTEIHVNNIVKTNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcagaggaagcaaaagctgtcattgttatcgtgcacggcgcaatg
gaatatcacggacgttacgaagccgttgcggaaatgtggaatcacatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaagcaagaaagtataggtta
cctatttttctattcggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaagagagaagatgtagatggtattattttgagttcgccttgtttaggggtagtgact
ggaccctctgctccgcttcaatttgctgcaaaaatattaaatgttttggctccaaaattg
caatttgcaacgaatcttacggtggaaatgtcaacaaggaatcatgaagtgagagatgca
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaattgctcataaaaaaatagacgattttccagacgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcatgtggtttgataat
gttaaaataggtgataaggcatataaagaatggccgaattgttatcacgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacatgtcaat
aatatagtaaaaacaaacaaataa

DBGET integrated database retrieval system