KEGG   Bacillus thuringiensis HD-771: BTG_25330Help
Entry
BTG_25330         CDS       T02293                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTG_25330
  Amino acid metabolism
   00300 Lysine biosynthesis
    BTG_25330
Enzymes [BR:bti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BTG_25330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4961935..4963341
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGEAE
GFASKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGESTIEGNTVTLQIKGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDILGEKATIAYKDEISGPLTVNVGRLSYTKENGGNLGLNVRYPVTTNFEE
TIAKLKEYVGTHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgattaattggacagaagaagttgcaaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatcggcgaaagagggcgca
ccattcggtgaaggggtagaaaaagcgctatctttcatgttacataaaggagaagctgaa
ggttttgcttctaaaaatttagaaggatatgcaggtcatcttgaaatgggacaaggagaa
gaattagtaggtattctttgtcacgttgatgttgtaccagaaggagatggctggacgact
cccgcatatagtgcggatattcgcgatggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttcaaaacgtgttcgtatgattataggaacagatgaagaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcaccagatgcagatttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgacgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaataggggaatcgactatagaaggtaatacagtg
acgttgcaaataaaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttgactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatattttgggtgaaaaagctactattgct
tataaagatgaaattagcggtccgttaacagtgaatgttggtcgcctttcttatacgaaa
gaaaacggtggtaacttagggctaaacgtacgttacccagttacaactaactttgaagaa
acaattgcgaagttgaaagagtatgttggtacgcatggatttgaagtagctgactattct
aattcacgcccgcatcacgttgataaagaccacgtattaattcgtacgttacaacgtgta
tatgaagaacaaacaggtgaaaaagcagaactattagcaattggcggaggtacttatgct
cgttcattaaaagctggtgtggcatttggaccgctattccctggaaaggaagaacttgcg
catcaaaaagatgagtacattgaaattgaagacttattaaaagcaacagcgatttatgcg
caagcaattcatgaattagcgaagtaa

DBGET integrated database retrieval system