KEGG   Bacillus thuringiensis HD-771: BTG_26260Help
Entry
BTG_26260         CDS       T02293                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00071  Fatty acid degradation
bti00362  Benzoate degradation
bti01100  Metabolic pathways
bti01120  Microbial metabolism in diverse environments
bti01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BTG_26260
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTG_26260
Enzymes [BR:bti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BTG_26260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFQ18651
UniProt: J3UTH1
Position
5137075..5137851
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGL
FSEESLLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggcgacgttaaatcat
gcaccagcaaatgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggaaaaggatgataacattcgtgttgttgttattcacggtgaaggacgtttcttctca
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcaacagaatta
gcacagcttggacaagttacgtttgagcgtgttgaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcactgggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctggc
tttgcaggtacacagcgcttaccacgttatgttgggaaagcaaaagcttgtgaaatgatg
ttaacaagtacaccaattactggtgcagaagcattgaaatggggacttgttaacggattg
ttctctgaagaatcacttttagatgatacgcttaaagtcgcaaaacaaattgctggaaaa
agtccagcaacaactcgtgctgtactagagttattgcaaacgaccaaatcgtctcattac
tatgaaggtgtacaacgtgaatcacaaatttttggtgaagtatttacgagtgaagatgga
agagaaggtgtagctgcatttttagaaaagcgtaaaccttcatttagtggcaggtag

DBGET integrated database retrieval system