KEGG   Bacillus thuringiensis HD-771: BTG_26965Help
Entry
BTG_26965         CDS       T02293                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bti00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTG_26965 (ruvA)
Enzymes [BR:bti01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BTG_26965 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5263263..5263880
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTAR
QMILDLKGKLADVVPDAFVDLFSDTERFDEKKGSSAELDEALEALRALGYAEREVSRVVP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaatatgttacaggttacgtggagtatgtagggccggaatatgtcgtaattgat
cataatggaattggttatcaaattttcacaccgaatccgtatgtatttcaaagaagtaag
caagaaatccgtgtctatacatatcattatgtgagagaagatattatggcactttacggg
tttaaaacacgtgaagagcgtttattatttacaaagttgttaggcgtgtctggcattggg
ccaaaaggcgctcttgcaattttagcttctggtcaaacaggacaggtcgttcaagcgatt
gagcatgaagatgagaagtttttagtgaaattcccaggcgtcggaaagaaaacagcacgc
caaatgattttagatttaaaaggaaaactagcagatgtcgtaccagatgcatttgttgat
ttattctcagacacagaacgttttgatgagaagaaaggttcatcagctgagcttgatgag
gcactggaagctctgcgtgcacttggatacgcagaacgcgaagtttctcgcgttgtacca
gagttattaaaagaatcattaacgacggatcagtatattaaaaaggcacttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system