KEGG   Bacillus thuringiensis HD-771: BTG_27100Help
Entry
BTG_27100         CDS       T02293                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bti03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5291623..5293959
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYMVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLVRETMSLLNNQEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKDGTLPPDLAQNKK
DRSFISCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIIPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFKSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacatatgacgaaaagaaagtcatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacattgacaggtcactttaaggaccatccaaagtatgga
aaacaatatatggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaagcgtacagcggaaaaaattgtg
gatcatctcggggaacatgctatttctaaaattatggatgaccctgaggcgttaaatggt
gttgttaacaaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagctttttaaatggttacggttttggaacgaaactttctattaagatt
taccagcaatataaagagatgacattagaagtgattcgtaataatccgtatcaacttatt
gaagaagtggacgggattggttttggacgagcggatgatatagggcgtgcgttaggaata
tcgggtaatcacgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctca
ttgcaacttggtcacgtttatatgaggaaagatcaacttgtaagagaaacgatgtcactt
ttaaacaatcaagaaggaagagtgactgaggaagatattataggttgtattgaaacgatg
caaagtgaagggaaagtcatcatagaagaagaacgagtgtatttagcaactttattctac
tctgaaaaaggtgttgtaaagtctattcgtcgattgatgaatcaagaggaaacaccttca
tttcctgaagcagaagtgttaaaaacattaggtgaaattgaagaacagttaaacgtgcag
tatgcaccgtttcagcaagaagcgattcaaacggcacttcataagccaatgatgttatta
acaggtggaccaggaacggggaaaacaactgttattaaagggattgttgaaatgtatgcg
tcacttcacggattatcgttaaatccgaatgaatacagtgatgataatccatttccaata
ttattaacagctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttcca
gcttgcacaattcaccgtttgcttggctggacgccagaaggatctttccagcgtaatgaa
acggatcctgtccaaggtaagctccttattattgatgaattttcaatggttgatatttgg
cttgcgaatcagctatttaagtcgctaccgacgaacattcaagttatcgttgtaggtgat
gaagatcagttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggc
gcagttccgacagtgaagcttactgaaatttatcgtcaagcagaaggctcatctgttatt
caacttgcccatgcaatcaaagacggcacgctcccgccagatttagcacaaaataaaaaa
gatcgttcatttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgc
gaaaatgctaaaacaaaaggatttagtgcaagggatgtccaagtattagcgccgatgtac
cgcgggcctgctggtattaatgtattaaacgaagcattgcaacaagtatttaatccgaag
agggaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagta
ctgcaactcgttaatcagccagagagccaggtgtttaatggtgatattggagaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacgtatacaaagcccgatttaaatcaaattacgcatgcatattgttgt
tccattcataaatcacaaggtagtgaatttccgattgttattataccgatcgtgaaaagt
tacaaccgtatgttacgtcgtaatttaatttacacgggcattacaagaagtaagaagttc
cttattatttgcggggaggaagcagctttcaaatccggtgtaaatcgccttgatgatgca
atgcgtcaaacaactttggctagtcgcttgcaggaatcacaaggagaagtacagatggtc
acagttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system