KEGG   Bacillus thuringiensis HD-771: BTG_27220Help
Entry
BTG_27220         CDS       T02293                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTG_27220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTG_27220
   00620 Pyruvate metabolism
    BTG_27220
   00650 Butanoate metabolism
    BTG_27220
  Lipid metabolism
   00071 Fatty acid degradation
    BTG_27220
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTG_27220
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTG_27220
   00626 Naphthalene degradation
    BTG_27220
Enzymes [BR:bti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTG_27220
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BTG_27220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5313895..5316498
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGQQALQTLESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKQDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSVAAAKTVYDAAMKAGAPKHCIQWIE
RPSVEATKQLMNHDGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIENNCYFVTEEERKKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPEHTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EKGFTYCEEMLNLGGLGHSAVIHSTNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVTHYLNKHANDVKIEVFFEVEPDPSDETVFKGAEMMRS
FKPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGNKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVMANDYTDGLALKAIDLVFKYLPRAYKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLVKAIIELGKSLNINMSIAGQGVDKEQFEEVVGVLAERAFE
DQCTTANPKLPLISELKEIYMEAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaagaggtaaaagagatgattgatacg
ttagtaaataacggtcaacaagctttacaaacattagaaagttttacacaagagcagatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcaaaa
ttggctgttgaagaaacaggccgtggtgtctatgaagacaaatgcattaaaaatattttt
gccactgaatatatttggcatagtataaagcaagataaaacggtaggaattattcacgaa
gatcctcatgaagaaataatagaaattgcagaacctgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacgtcgacaacaatgtttaaagcgttgattgcgataaaaacgaga
aatccaattattttcgcatttcatccttctgcacaaaattgttcggtggcagcagcgaaa
accgtatatgatgcagcaatgaaagctggtgcaccaaaacattgtattcaatggattgaa
agaccgtctgtcgaagcgacgaaacaattaatgaaccatgatggtgtggcactcgttcta
gcaactggaggcgctggtatggtgaaatcagcttactctactggaaaaccagcgctaggt
gtaggtcctggcaatgtaccgtgttatatagaaaaatcagcacatataaaacgagctgtt
aatgatttaattttatcgaaaacatttgataacggtatgatttgtgcatcggaacaagca
atcattgtcgataaagaaatctatgatgatgttaaaacagaaatgatcgaaaacaattgt
tactttgtaacagaagaagaaagaaaaaaattagaaaagctcgttattaatgaaaataca
tgtgcagtaaatagtgatattgtaggaaaatcagcacagtatattgccgaattagttggg
attactgttcctgaacatacaaaaatgcttgtagctgaaattcaaggtatcggagcagca
tacccgttatctcgtgagaaactgagcccagtattagcctgtgtgaaggcgaattcatta
gaaaaaggatttacatattgcgaagaaatgttgaacctcggtggtttaggacattcagca
gttattcattctacaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgtctcattgtaaatgcaccttcatcacaaggtggaataggggatatatataacggattt
attccatcacttacacttggttgtggttcttacggaaaaaattcagtttcccaaaatgta
acagcgactcatttattaaatataaaaaggctggcaaatagaaaaaagaatatgcagtgg
ttcaaattgccaccaaaaatttattttgaaaaacatgctacagcgtatttagcaaatatg
cctaacatttcacgtgcatttattgtaacggatcctggaatggttgaacatggctatgtg
gatacagtcacgcactatttaaacaagcatgcaaatgatgtgaaaattgaagttttcttt
gaggtcgaaccagatccatcagatgaaactgtctttaaaggtgcggaaatgatgagaagc
tttaagccagatgtaattatcgcacttggtggtggttcagctatggatgcagcaaaagga
atgtggttattctatgagcatccagaaacgacattctatggcattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccggaattaggaaataaggcacagtttgttgcg
attccaacaacatcaggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccgctcgcagattatgaattaacaccagatgtagcaattgtt
gatccgcaatttgtaatgacagtaccaccacatgtaacagcagatactggtatggatgtt
ttaacacatgcaattgaggcgtatgtgtctgttatggcaaatgactatacagatggatta
gcattaaaagctattgatctcgtattcaaatatttaccgagagcatataaagatggaaat
gatgaagaagcacgggaaaaaatgcataacgcttctgcaattgcagggatggcatttgca
aatgcttttctaggtattaatcacagcttagcacataaaattggtccagaattccatatt
ccgcacggacgtgcaaatgcaattcttatgccgcatgtagtccgctataatgctattaag
ccaagaaaacacgcattgttccccaaatatgagcactttgtagcagatgaacgctatgca
catattgcgagaatgctcgggcttccagcaagctcagtagcagaaggtgtggaatcactc
gtcaaagcaattattgagcttggaaaaagcttaaatattaatatgagtattgcaggacaa
ggggtagataaagagcaatttgaagaggttgttggagtattagcagaaagagcttttgaa
gatcaatgtacaactgctaatccaaagttaccgcttatttcagagctgaaagaaatttat
atggaagcatataaaggtgaataa

DBGET integrated database retrieval system