KEGG   Bacillus thuringiensis HD-771: BTG_27815Help
Entry
BTG_27815         CDS       T02293                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00010  Glycolysis / Gluconeogenesis
bti00052  Galactose metabolism
bti00500  Starch and sucrose metabolism
bti00520  Amino sugar and nucleotide sugar metabolism
bti00521  Streptomycin biosynthesis
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
bti01130  Biosynthesis of antibiotics
bti01200  Carbon metabolism
Module
bti_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bti_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTG_27815
   00052 Galactose metabolism
    BTG_27815
   00500 Starch and sucrose metabolism
    BTG_27815
   00520 Amino sugar and nucleotide sugar metabolism
    BTG_27815
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BTG_27815
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BTG_27815
Enzymes [BR:bti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BTG_27815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AFQ18962
UniProt: J3X4Z6
Position
5426367..5427350
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTGEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETNKESMLRSMLAEEGRITSKDVFEALGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtatacggtgaaattttacataagtgggaaatccctacgaatacaggtgagcaa
ggaaaacatattacacttgatgttgcgaaagcaattgataaaaagctagaagaattaggc
gaattgaagagcaagttaattggtattggtatgggagctcctggccctgtacatgtggca
tctggaatgatttatgaagcggttaatttagggtggaaaaactatccgctaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaacttagcagcgctt
ggtgaaatgtggaaaggtgctggtgaaggtgcaaaagatttaatctgcatgacacttggt
acgggcgttggtggtggtgtaatcgccaatggtgagattgtacacggcgtgagtggtgct
gctggtgagattggacatattacagtagttacagaaaatgctttcccatgtaattgcggg
aagtctggttgcttagaaacagtagcatctgcaacaggtattgtacgtgttgctatgcaa
aaaatacaagagactaataaagaaagcatgttgcgttctatgttagctgaagaaggacgt
attacatcaaaagatgtctttgaagcacttggacaaggtgatgaattagcaggcgaagta
gtagaaaaagtagcttcttatttaggattagctgtagcaaacctttctagtacgttgaac
ccagagaaaattgttattggtggaggcgtgtctaaagctggagatgcgctattagaacca
attcaacgctatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system