KEGG   Bacillus thuringiensis HD-771: BTG_29225Help
Entry
BTG_29225         CDS       T02293                                 

Definition
5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bti00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5658257..5658769)
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAVF
SKEIADVSASRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgcattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaacatttctaaacttcctact
catttaaatgaaaattattcgttaacagatgaaaacaaagctgaaatattagctgttttt
tcaaaagaaatcgctgatgtttcagcaagtcgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaaccttgacgaattattaattaatttccaaaaagaacatcat
catacagatgacgaagttcgctttatcgtcagtggtcatggcattttcgctattgaaggc
aaagatgggaaattctttgatgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system