KEGG   Bacillus thuringiensis HD-771: BTG_29305Help
Entry
BTG_29305         CDS       T02293                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bti  Bacillus thuringiensis HD-771
Pathway
bti00071  Fatty acid degradation
bti00072  Synthesis and degradation of ketone bodies
bti00280  Valine, leucine and isoleucine degradation
bti00310  Lysine degradation
bti00362  Benzoate degradation
bti00380  Tryptophan metabolism
bti00620  Pyruvate metabolism
bti00630  Glyoxylate and dicarboxylate metabolism
bti00640  Propanoate metabolism
bti00650  Butanoate metabolism
bti00900  Terpenoid backbone biosynthesis
bti01100  Metabolic pathways
bti01110  Biosynthesis of secondary metabolites
bti01120  Microbial metabolism in diverse environments
bti01130  Biosynthesis of antibiotics
bti01200  Carbon metabolism
bti01212  Fatty acid metabolism
bti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTG_29305
   00630 Glyoxylate and dicarboxylate metabolism
    BTG_29305
   00640 Propanoate metabolism
    BTG_29305
   00650 Butanoate metabolism
    BTG_29305
  Lipid metabolism
   00071 Fatty acid degradation
    BTG_29305
   00072 Synthesis and degradation of ketone bodies
    BTG_29305
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTG_29305
   00310 Lysine degradation
    BTG_29305
   00380 Tryptophan metabolism
    BTG_29305
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTG_29305
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTG_29305
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTG_29305
Enzymes [BR:bti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTG_29305
Exosome [BR:bti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTG_29305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AFQ19256
UniProt: J3UUN5
Position
5671315..5672490
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSDVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGHFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttggaggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacatgaagttgatgaagtaattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacagctgcattagcggcaggatttcctgacacagttacg
ggatatacaatccaacgtcaatgttcttcaggtatgcaagcaattatgtcagctgcaatg
caaatccaattaggtgtaagtgatgttgttgttgcaggtggagtagaagcgatgagttcg
agcccttatgcattgaaacagcaccgctggggacaacgtctacagcacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcaccatattatgatgggtgaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgctcttcgc
agtcatacattggcactgaaggcaatcgagtctggacactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgagcatccacgtgca
gatattacagcggaaaaattagcagggttaaaaccagcattccgtaaagatgggtctgta
actgcaggtaatgcatctggcctgaatgacggaagtgcagttctagtattaatgagcgaa
gaaaaagcaaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagacccgaaaattatgggtattggaccagcaccagcaatccgaaaaggattagag
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgcggct
caatatttagctgtagagaaagagttaggtttagaccgtgaaaaagtgaacgtaaacggt
agtggcgtaggacttgggcatccaattggttgtacaggggctcgtattacagtaagttta
attcacgaattaaaaagacgtggtttagaaaaaggaattgcctctttatgcgttggtggc
ggtatcggggttgccttatttatagaagcactataa

DBGET integrated database retrieval system