KEGG   Burkholderia thailandensis E444: BTJ_2131Help
Entry
BTJ_2131          CDS       T03112                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btj  Burkholderia thailandensis E444
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTJ_2131
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTJ_2131
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTJ_2131
Enzymes [BR:btj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTJ_2131
Exosome [BR:btj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTJ_2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:complement(2443879..2445279)
Genome map
AA seq 466 aa AA seqDB search
MSTIKRIAAAFAAAALSGGVGQAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEAGQL
TMETLPRTARIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAVAPGSDANGNK
TVNNCGANNGKPVPTLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQA
VPGGAGYNAALGDGVDVLMGGGRNHWTPYDPVANKRGRADGRNLLAELQAKGYAVAATKD
QLAQAGGGKLIGLFSATSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLRKNPNGYFLM
VEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSNTLIVVTADHDHTLTINGYAK
RGNPVLDISRSYRDGQPNRDADGNTYTTLVFGNGANRPNVRTPVDSASATNEAYLQEVGV
RMGGAGSETHGGGDVMLFADGADAKAFKGTLDNTKVFGLVKSAFGF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcggcggcgttcgccgcggcggccctttcgggcggtgtc
ggccaggcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgacggg
atggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaggccggccaactg
acgatggagacgctgccgcgcaccgcgcgcatcaagactttctcgaacgacgcgcagacc
accgacagcgcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgaggtg
ctgtcgatgtcgccggacacgcgcgcggtcgcgcccggcagcgacgcgaacggcaacaag
acggtgaacaactgcggcgcgaacaacggcaagccggtgccgacgctgctcgagctcgcg
aaggcgcggggcaaggcggtcggcgcgatcacgacgaccgagctcacgcatgcgacgccc
gccgcgacgtactcgcacatctgccatcgcgatgcgcagtacgacatcgccgcgcaggcg
gtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatgggc
ggcggccgcaatcactggacgccgtacgatccggtcgcgaacaagcgcggccgcgcggac
gggcgcaatctgctcgccgagctgcaggcgaagggctacgcggtcgcggcgacgaaggac
cagctcgcgcaggcgggcggcggcaagctgatcgggctcttcagcgcgacgagccatctc
gagtacgagctcgatcgcgtcgcgggcaagggcgagggcgcgacgcagccgagccttgcg
gagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctgatg
gtcgaaggcgggcgcatcgatcacgcgctgcacggcacgaacgcaaagcgcgcgctcgaa
gacacggtggcgttcgacgaggcgattcgcaccgcgctcgcgaaggtcgatctgtcgaac
acgctgatcgtcgtgacggccgaccacgaccacacgttgacgatcaacggctatgcgaag
cgcggcaatccggtgctcgacatcagccgcagctatcgcgacggccagccgaaccgggac
gcggacggcaacacgtatacgacgctcgtgttcggcaacggcgcgaatcgcccgaacgtg
cgcacgccggtggattcggcgagcgcgacgaacgaagcgtacctgcaggaagtcggcgtg
cggatgggcggcgcgggctccgagacgcacggcggcggggacgtgatgctgttcgccgac
ggcgccgacgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctcgtg
aaatcggcgttcgggttttga

DBGET integrated database retrieval system