KEGG   Burkholderia thailandensis E444: BTJ_4612Help
Entry
BTJ_4612          CDS       T03112                                 

Definition
fatty acid desaturase family protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
btj  Burkholderia thailandensis E444
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:btj00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BTJ_4612
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BTJ_4612
Enzymes [BR:btj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BTJ_4612
Lipid biosynthesis proteins [BR:btj01004]
 Desaturase
  First
   BTJ_4612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2:complement(1555679..1556713)
Genome map
AA seq 344 aa AA seqDB search
MSSGQPPSTNEGASQPEGAIGSAIPASFPSGSHGFARPTTVSPRSAVRLDRRIAAVVTLL
PALGTAAAIALWIGGHGPGAAEWIVFAIFYFATALGLEVGFHRHVTHKAFKAKPWVRAAL
IALGSMGAHGPVNWWASTHRRHHSTSDGCGDPHSPHLSGDGIGGRLKGLYHSHMGWLFVG
ESTRPAGWEKYVPDLYQDPLVFRQHMAYYRWVAIGLVLPPFVCGLASRSWMGVLLGFLWG
DMARIFAVSHCIWALNSLCHVIGRRDFHTTAHDRSRNSLLLAIPTFGQGWHNNHHAFPAS
AFTGLHWWQIDPGGLFVRVLERLHLVYDVHRPNAELIEKKRIAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggccagcctccgtccacgaacgaaggtgcgagccagcccgagggtgcgatc
ggaagcgcgattcccgcgtcttttccttccggttcgcatggcttcgctcgcccgacaacg
gtttcgccccgctccgccgtccgtctcgatcgccgcatcgccgccgtcgtcacgctgctt
cccgcgttgggcacggccgccgcgatcgcgctgtggatcggcggtcacgggccgggcgcc
gccgaatggatcgtgttcgcgatcttctatttcgcgaccgcgctcgggctcgaagtcggc
tttcatcgccacgtgacgcacaaggcgttcaaggcgaagccgtgggtgcgcgccgcgctg
atcgcgctcggctcgatgggcgcgcacggtcccgtcaactggtgggcgtccacgcaccgc
cgccatcattcgacgagcgacggctgcggcgatccgcattcgccgcacctgtcgggcgac
ggcatcggcggccggctcaagggcctctatcacagccacatggggtggctgttcgtcggc
gaatcgacacgcccggcgggctgggagaagtacgtgcccgacctctatcaggacccgctc
gtgttccggcagcacatggcgtactaccgctgggtcgcgatcgggctcgtgctgccgccg
ttcgtctgcgggctcgcgtcgcgctcgtggatgggcgtgctgctcggcttcctgtggggc
gacatggcgcgcatcttcgcggtcagccactgtatctgggcgctgaactcgctgtgccac
gtgatcggccggcgcgacttccacacgaccgcgcacgaccgcagccgcaacagcctgctg
ctcgcgatcccgacgttcgggcagggctggcacaacaatcatcacgcgttccccgcgtcc
gcgttcaccgggctgcactggtggcagatcgatccgggcgggctgttcgtgcgcgtgctg
gaacgcctgcacctcgtctacgacgtgcatcgcccgaacgcggaactcatcgaaaagaag
cgcatcgcaccatga

DBGET integrated database retrieval system