KEGG   Bacillus thuringiensis 97-27: BT9727_0021Help
Entry
BT9727_0021       CDS       T00179                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
27574..28170
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAKALVNAKRDLAYCSVC
GHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVYHVLRGAISPMEGIGPE
DINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatcaaaactaattgatagttttatgaaattgccaggaatc
ggaccgaaaacagcggttcgattggcatttttcgtattagatatgaaagaagatgatgtg
ttaggttttgcaaaagcacttgtaaatgcaaagcgagacttagcgtattgttctgtatgc
gggcatattactgaccgtgacccttgttatatttgtaacgattcacatcgagatcaatca
gttgtttgtgtcgtacaagaaccgaaagatgtaatcgcaatggaaaagatgaaagagtat
caaggtgtatatcatgtgttacgtggtgctatctctccaatggagggaattggaccagaa
gacattaatatcccgcagcttttaaagcgactgcacgatgaaacggtacaagaagtaata
ttagcaacaaatcctaatattgaaggggaagctacagcgatgtatatatcccgcctctta
aagccgacaggtattaaagtaactcgtattgcacatggtctgccagttggtggagattta
gaatatgcagatgaagtgacactgtcgaaagcgttagaaggtcgtagagaagtataa

DBGET integrated database retrieval system