KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0067Help
Entry
BT9727_0067       CDS       T00179                                 

Gene name
sul
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00790  Folate biosynthesis
btk01100  Metabolic pathways
Module
btk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BT9727_0067 (sul)
Enzymes [BR:btk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BT9727_0067 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD PEP_mutase Sacchrp_dh_NADP DUF2103
Motif
Other DBs
NCBI-GeneID: 2853675
NCBI-ProteinID: YP_034425
UniProt: Q6HPU5
Position
77512..78354
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacgttaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttataatgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgct
catattattgatattggtggcgaatctactcgtccgggttttgctaaagtatcggtggaa
gaagaaataaaacgagttgttccgatgattcaggctgtttcaaaagaggtaaaattgcct
atttctatcgacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcat
attattaatgatatttggggagcgaaggcagaaccaaaaatcgctgaagttgcagctcat
tacgatgtacctattatcttaatgcacaatcgcgataacatgaattatcgtaatttaatg
gctgatatgattgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcga
gatgagaatatcattttagacccgggtatcggttttgctaaaacacctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcaagaaagtcctttattgggcatgtgctagatttaccggtagaagaacgtcttgaggga
acgggagctaccgtttgtcttggtattgaaaagggttgtgagtttgttcgcgttcatgat
gtgaaggaaatgtcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaag
taa

DBGET integrated database retrieval system