KEGG   Bacillus thuringiensis 97-27: BT9727_0149Help
Entry
BT9727_0149       CDS       T00179                                 

Gene name
rocF
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:btk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
158334..159227
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcggttattggagttccaatggatttagggcagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtagatcatattatagaagaagggcgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgtggcgaaacattataaaaacctaggtgttatttggtac
gatgcacatggtgatttaaatacagaagaaacttcaccatctgggaatattcacggtatg
tcacttgcagcaagtttagggtatggacatcccacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtcattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattcacaatgcacgagattgatcgtatg
ggtatgacagctgttatggaagaaacaattgaatatttatctcatactgacggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcctatcttatcgtgagagccatttagcaatggagatgttagcggaagctgat
attgttacatctgcggagtttgttgaggtaaatacgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system