KEGG   Bacillus thuringiensis 97-27: BT9727_0165Help
Entry
BT9727_0165       CDS       T00179                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:btk01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:btk00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btk00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:btk00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:btk00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:btk00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(179810..180718)
Genome map
AA seq 302 aa AA seqDB search
MKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVSTGDCRIRGFNSPLLFWIPMR
LILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFALTELNLGGYAEYTCVHESGLI
TLKPTNVTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIYGASGSVGTAAIQLAKYFGAT
VTAVCSNSNFELVQSLGANKVIDYTKEDFTKQGERYDIIFDAVGKHKKSLCKQVLAPNGK
YVSVNGMMAKVSKEDMILLKKLTETEHLKPVIDRTYRLEEIAEAHMYVEIGHKKGNVSIT
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatcatttgcacacagtatggaccacctaacgttcttcagcttcaaaatatc
gagaaacctatacctaaaaagaacgaagtattagttaaaattcacgcaacaagtgtatcg
actggagattgtagaatacgcggatttaatagccctctattattttggattcctatgcga
cttatattaggacttagaaaaccgagaaaccctatacttggcgtagaattagcaggagag
atagaggatatcgggacggatgtaactcaatttaaaaaaggggatcaaatttttgcatta
acagagctcaatcttggtggttatgccgaatacacatgcgtgcatgaaagtggattaata
acattaaaacctaccaatgtaacgtatgaagaagcggcagttattccttttggtggaact
tcagcgttgcactttctgagaaaaggccggataaaaaaggggcaacaagttctcatatat
ggtgcctccggatcagtaggaacagctgccatacaacttgctaaatatttcggcgcaacc
gttacggctgtttgtagtaattcaaattttgaactcgtgcaatctttaggggctaataaa
gtaattgattatacgaaagaagattttactaagcagggtgagcgctacgatattatattt
gatgcagttggaaagcataaaaaatccctttgtaaacaagtattagcgcctaatggaaaa
tatgtatctgtgaatggaatgatggcaaaagtaagtaaagaggatatgattctactaaaa
aaactaactgaaacagaacatttaaaacctgttattgatagaacttaccgattagaagaa
attgctgaagctcatatgtatgtggaaatagggcataaaaaagggaacgtttctattacc
ttaaaataa

DBGET integrated database retrieval system