KEGG   Bacillus thuringiensis 97-27: BT9727_0189Help
Entry
BT9727_0189       CDS       T00179                                 

Gene name
modA
Definition
molybdenum ABC transporter periplasmic molybdate-binding protein
Orthology
K02020  
molybdate transport system substrate-binding protein
Organism
btk  Bacillus thuringiensis 97-27
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:btk02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(205672..206478)
Genome map
AA seq 268 aa AA seqDB search
MNKFTLRSIGALILSFLLIFSVACTSGDKKEKSTATEGKTVELTISAAASLQDALKEIET
KYKEKEPNIKLSFNFGASGALQQQIEQGAPADLFFSAAEDKFQTLVKKGFINEKEGKNLL
GNELVLVVPKGSSLTKIQDLKDEKIKKIALGTPESVPAGKYAKASLTHENLWNDVQNKVI
FTKDVRQVLTYVETGNVDAGIVYKTDALISDKVKIGETAATNSHVPIHYPLGVIKESKHK
KEATSFYEYLQSKDTQSIFKKYGFTVLP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtttacattacgatccatcggggcacttatcctttcttttcttcttatattt
agtgttgcatgtacaagcggagataagaaagagaaatcaactgctacagaaggaaaaaca
gttgaacttactatatcagcagctgcaagcttacaagatgcgctaaaagaaattgaaaca
aaatataaagaaaaagaacctaatattaaactttcttttaacttcggcgcttctggtgca
cttcaacaacaaatcgaacaaggtgcacctgctgatttattcttctcagcagccgaagat
aaattccaaactcttgttaaaaaaggattcattaatgaaaaggaagggaaaaatcttctt
ggaaatgagctcgttctagtcgtcccaaaaggtagttctcttacaaaaattcaagattta
aaagatgaaaaaataaaaaaaatcgcacttggtacacctgaatctgtacctgcgggaaaa
tacgcaaaagcttctctcacacatgaaaatctttggaatgacgttcaaaataaagtcata
tttacaaaagatgtgcgccaagtgttaacatatgtagaaacaggtaatgttgatgctggt
attgtatacaaaacagatgctcttatttcagacaaagtaaaaatcggcgagacagcagca
actaattctcatgtgccaatccactatcctttaggcgttataaaagaatcaaagcataag
aaagaggcgacttcattttatgagtatttgcagtcaaaagatacacaatctatctttaag
aaatatggatttacagtcctaccataa

DBGET integrated database retrieval system