KEGG   Bacillus thuringiensis 97-27: BT9727_0317Help
Entry
BT9727_0317       CDS       T00179                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BT9727_0317 (fucA)
Enzymes [BR:btk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BT9727_0317 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
376686..377327
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagaaattgtagcgtatggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagagggagagagaaaaccatcaagtgaattagatatgcac
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccctat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcatatttaattgctttc
gcaggccctaatgttcgttgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgcttttgaaggaatgattgatcgtcgtgctgttttacttgcgaaccacggtttaatt
gcaggtgcaaatcatataaaaatggcatttaccgttgcagaagaaattgagttttgtgca
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaaggatatgggcagcagtag

DBGET integrated database retrieval system