KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0414Help
Entry
BT9727_0414       CDS       T00179                                 

Gene name
glsA
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00220  Arginine biosynthesis
btk00250  Alanine, aspartate and glutamate metabolism
btk00471  D-Glutamine and D-glutamate metabolism
btk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BT9727_0414 (glsA)
   00220 Arginine biosynthesis
    BT9727_0414 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BT9727_0414 (glsA)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BT9727_0414 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-GeneID: 2855181
NCBI-ProteinID: YP_034764
UniProt: Q6HNV6
Position
complement(481046..481975)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMDRILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKEKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatatacg
aaaaaaggaaagcttgctacttatatccccgaactaggaaatgccaatccagatgattta
gggattgccattttccataaagaaacagaatacatccatgctggcaactcacaaacacta
ttcactcttcaaagtatttcaaaagtaattacacttgcacttgcacttttagatcgtggt
gaagaatatgtattttctaaagttggaatggagccaactggtgatccatttaattctatt
attaagttagaaacgacgagtccttctaaaccacttaatccaatgattaatgcaggggca
ctagccattacaagcatgttagcaggaaaagataatgaagaaaaaatggatcgcattctt
catttcgtacgtgaaataacagataatcctactattaattattcttctaaagttgccaat
tcagaattagagacagcttacttaaatcgttcactttgttactatatgaaacaaaacgga
attattgattgtgatatcgaagaactgatggatttatacactcgtcaatgtgcagttgag
gtaaactgtatcgatttagcacgtatcggtttaatttttgcgatggatggatatgatcca
tataaggaaaaacaaattatccctaagcatattacaaagatttgtaaaacatttatggtt
acatgcggtatgtataacgagtctggtgaatttgcgattcgtgttggtatccccgcaaaa
agtggtgtagctggtggcattttcggctgcgtaaaaggagaaatgggaattggtattttc
ggaccagctttagatgcaaacggaaatagtatcgctggttttaaaattcttgaacttctt
tctgcccaagaaggttggagcattttttaa

DBGET integrated database retrieval system