KEGG   Bacillus thuringiensis 97-27: BT9727_0576Help
Entry
BT9727_0576       CDS       T00179                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BT9727_0576 (rbsK)
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BT9727_0576 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674094..674990
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVKKNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICEEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRVVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggtaggagcg
gtaggagacgataattatggaactgtagtgaagaaaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcggcgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtgcaaggggcgaatgctcttgtaaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattggctatttgtgaggaacacaaaatcccggttatg
ttaaatccagcaccggcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acaccaaatgaacatgagtgccgcgtcgtattagatgatttcacatcgccaattgaagat
ttactggctaaatatccgaataaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggggcg
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcgggtga

DBGET integrated database retrieval system