KEGG   Bacillus thuringiensis 97-27: BT9727_0878Help
Entry
BT9727_0878       CDS       T00179                                 

Gene name
bglH
Definition
glycoside hydrolase family 6-phospho-beta-glucosidase (EC:3.2.1.-)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_0878 (bglH)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BT9727_0878 (bglH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981681..983120
Genome map
AA seq 479 aa AA seqDB search
MSKVIFPKGFLWGGAIAANQVEGAYVEDGKGLTTVDLLPTGENRWDIMKGNIHSFTPVEG
EFYPSHEAIDFYHRYKEDIALFAEMGFKALRVSIAWTRIFPNGDDEKPNEAGLQFYDNLF
DELLKHDIEPVVTMAHFDVPIHLVEKYGSWRSRKLVDFFETYAKTIFNRYKDKVKYWMTF
NEINMLLHLPFMGAGLAFKEGDNKKQIQYQAAHHQLVASALAVKACHEIIPDAKIGCMLA
AGATYPYTCNPDDIQRAMEQDRESFFFIDVQARGAYPGYAKRFFTDNNVTIEMEKEDEAI
LKEHTVDYIGFSYYASRATSTDPEVLKSITSGNVFGSVENPYLEKSEWGWTIDPKGFRIT
ANQLYDRYQKPLFVVENGLGAIDQLNDEDEVNDAYRIDYLEKHMIEMSEAIQDGVDIIGY
TSWGPIDLVSASTGEMKKRYGYIYVDKDNEGKGSLKRSKKDSFNWYKEVIATNGGSLES
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagttatttttcctaaaggatttttatggggtggagcgattgcagccaatcaa
gttgaaggcgcatatgtagaagatggaaaaggattaacgacggtagatttattaccaact
ggtgaaaaccgctgggatattatgaaaggaaatattcattcctttacaccggtagaagga
gagttttatccatcacatgaagcaattgatttttatcatcgttataaagaagatattgct
ttatttgcagaaatgggatttaaagcgttacgtgtatcgattgcttggacgcgtattttc
ccaaatggtgatgatgaaaaaccaaatgaggctgggttacagttttatgataatttgttt
gatgaactgttaaagcatgacattgaaccagtcgttacgatggctcacttcgatgtgcct
attcatttagtagaaaagtatgggagctggagaagtagaaaacttgtagacttcttcgag
acgtatgcaaaaacgatttttaatagatataaagataaagtgaaatattggatgacattt
aacgaaattaatatgcttttacatttacctttcatgggagcaggtctagcatttaaagaa
ggtgacaataaaaaacaaattcagtatcaagcagcgcatcaccaacttgttgcaagtgcg
ttagctgtaaaagcgtgtcatgaaatcattccagatgcaaaaatcggttgtatgcttgct
gctggtgcaacgtatccatacacatgtaatccagatgacattcagcgcgcgatggaacaa
gaccgtgaatcattcttcttcattgatgtacaagcaagaggcgcatatcctggatacgca
aaacgcttctttacagataataatgtaacaattgaaatggaaaaagaagatgaggcaatt
ttaaaagagcatacagttgattatattggatttagttattatgcaagccgagcaacaagt
acagatccagaagtgttaaaaagcataacgagcggaaatgtattcggttctgttgaaaat
ccatatcttgaaaaatcagagtggggatggacgattgatccgaaaggcttccgtattaca
gcgaaccaactttacgatcgttaccaaaaacctttatttgttgttgaaaacggccttggt
gcaatcgatcaattaaatgatgaagacgaagtgaacgatgcataccgtattgattatcta
gagaagcatatgattgaaatgtccgaagccatccaagatggagtagatattatcggttat
acaagctggggcccgattgaccttgtaagtgcttctactggagaaatgaaaaaacgttac
ggatatatatacgttgataaagataatgaaggaaaaggttcattaaaaagatcgaagaag
gacagtttcaattggtataaagaagtaattgcgacgaatggtgggagtttggagtcttaa

DBGET integrated database retrieval system