KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_0986Help
Entry
BT9727_0986       CDS       T00179                                 

Gene name
hemY
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00860  Porphyrin and chlorophyll metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BT9727_0986 (hemY)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BT9727_0986 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BT9727_0986 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Pyr_redox_2 HI0933_like Pyr_redox_3 DUF4988
Motif
Other DBs
NCBI-GeneID: 2857256
NCBI-ProteinID: YP_035325
UniProt: Q6HM96
Position
1082116..1083537
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPSGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKAEPKKGIFQTVKTGLESIVESLELKMH
EGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNI
PSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRPGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTVVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKRVLSHLEKVMNTELIAQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaagttgtaatcatcggcggtggcatcacaggattaacaacaatgtatcac
ttacaaaaagatattcgtgacaagaacttgccgattgatacattactgatagaagcatcg
ggtaaacttggcgggaaaattcaaaccgttcgaaaagatggatttacaattgaacgcgga
ccggattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgagcttgtaaataatcaggccggtcaatcatttatcctcgtaaacaatcggtta
cataaaatgccgagcggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tctgggctgttctccccaattgggaaactaagagctggttttgatctattaatgccgaga
tcaaaaccagtatctgaccaatcactcgggcactttttcagacatcgcctcggaaatgaa
gtggttgaaaatttaatagaaccattactatctggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacatttccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgccccgaaagcggagaaagctgaaccgaaaaagggaatc
ttccaaacagtgaaaactggtttagaatctatcgtagaatctctcgaattaaagatgcat
gaaggtacgataataaagggaactcgcatagaaaaagttgcaaaacagggtgatggctat
gcgattactcttagtaacggaaaagaaatagaagcggacgcggtcgtagtggcaagctca
cataaagtattgccatctatgtttgcgcagtacaagcaatttcgtttcttccgcaacatt
ccatccacatcagttgcgaatgtggcaatggctttcccgaaatcagccattcagcgggat
attgatggtacaggatttgttgtctctcgaaatagtgattacacaattacagcatgtacg
tggacgcataaaaagtggccacatacaacgccagaaggaaaaacgcttcttcgatgttac
gttggacgacctggtgatgaagcggttgtagaacaaacagaagaggaactcgttcagctc
gtactagaagacttacgaaagacgatggatattacagaggatccagagtttacagtcgta
agtcgctggaaagaagcaatgccccaatatacagtaggtcataacgagcgaatgaagaaa
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagttcttacgct
ggttctggtcttccggactgtattgatcaaggtgagaaggctgcaaaacgtgtactctct
catttggagaaagtaatgaatacggaattaatcgcacaataa

DBGET integrated database retrieval system