KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1027Help
Entry
BT9727_1027       CDS       T00179                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00630  Glyoxylate and dicarboxylate metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01200  Carbon metabolism
Module
btk_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BT9727_1027 (aceA)
Enzymes [BR:btk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BT9727_1027 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 2853631
NCBI-ProteinID: YP_035365
UniProt: Q6HM56
Position
1123666..1124943
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLAHRGAEKLWASLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLDDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacgcgttggaaa
gggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatcaattgatatt
gagcatacattagcgcaccgcggtgctgaaaagctttgggcatcgcttcatacggaagat
tacattaacgcacttggtgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacttgtctggacat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgtaaaacgaatt
aatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggtgatacagat
tatttcgtgccgattgtagcagatgcagaagctgggtttggcggacaattaaacgtattt
gaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaagatcaatta
tcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacgcaaacagcg
gtgcgtaatttaatttcggcacgccttgcggcagacgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgatcctgttgat
aaagcgtttattacaggcgaaagaacaccagaaggattttaccgtacgaaagcaggtctt
gaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtttggtgtgaa
acatctgaaccaaatttagatgatgcaaaacgatttgcggacgcaattcataaagagcat
ccagggaaattgcttgcatataactgttcaccttcatttaactggaaacaaaaactagat
gagaaaacaattgcgagcttccaaaaagaaatcgcatcttacggttataagttccagttc
gtaacacttgctggattccattcattaaactacggcatgttcgaattagcacgcggctat
aaagagcgcggcatggcagcgtactctgaactacaacaagcagaattcgcagcagaaaaa
catggctactctgcaactcgtcaccaacgagaagtaggaacaggttactttgatgaagta
gcacaagtcattacaggcggtacttcatcaacgacggcattaaaaggatctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system