KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1157Help
Entry
BT9727_1157       CDS       T00179                                 

Gene name
odhB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00020  Citrate cycle (TCA cycle)
btk00310  Lysine degradation
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
Module
btk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BT9727_1157 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BT9727_1157 (odhB)
Enzymes [BR:btk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BT9727_1157 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-GeneID: 2854389
NCBI-ProteinID: YP_035492
UniProt: Q6HLS9
Position
complement(1247099..1248358)
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAAAPSAEQTATLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagacgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgctgagcaaccaaaacaagaaacagctgaa
gcaccaaaagctgcggcaccaagtgctgaacaaactgcaactctacaaggtttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagtt
gcaaaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaa
catgatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcg
aaccaattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgt
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtgttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttagga
atgcacaaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgccca
atgatgtacatcgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system