KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1290Help
Entry
BT9727_1290       CDS       T00179                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00340  Histidine metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01230  Biosynthesis of amino acids
Module
btk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BT9727_1290 (hisD)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BT9727_1290 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 2856337
NCBI-ProteinID: YP_035624
UniProt: Q6HLE7
Position
1372395..1373684
Genome map
AA seq 429 aa AA seqDB search
MEIVCEDFQKVLTKIKLLRENANIIEETVQRSVREIVQNVRESRDEALFFYTKKFDGVEI
KDVRVSEEEIKQASMFVESSFLEALQEAKKNIISYHEKQKRQSMFDCTSKGIIRGQIIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRAGGIDPHILVAASLAGVDE
IYMIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIN
RNGAIFIVPSIDEALQLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEEALRDVKHHIVELANKEGLHAHAKA
IQIRFGEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtttgtgaggattttcaaaaggtgttaacgaaaataaaactgttacgagaa
aacgctaatataatagaagaaactgttcaaagaagtgtcagggaaatcgttcagaacgta
agagagagtagagatgaggcgttatttttctatacaaaaaagtttgatggtgtagagatt
aaagatgttcgtgtaagtgaagaagaaataaaacaagcgagtatgtttgtagagagttca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatcgatgtttgattgcacgagtaaaggcatcataaggggacaaatcattcggccg
ttagaaaatataggggtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaagcttgcgggtgtgaaaaagattgtaatggtaacaccgcca
agagcaggaggaattgatccgcatattttagttgctgcaagccttgcaggagtagatgaa
atttatatgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccaaaagtagataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggaccgtcagaaatagtagttattgct
gatgaaactggcaatgcaaaatatattgctgcagatttattatcacaagcagaacatgat
gagagagcgacagcaatttgtattacaacgaatatagaattagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaat
agaaatggagccatttttatcgttccttctatagatgaggcactacagttatcgaatgaa
atcgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccgtatgcaccagaaccgctcggtgattattta
gcgggaccgaatcacgtattaccgacaagtggaacggcaaggtttttctcgccgttatca
gtcgatgatttcgtgaaaaaatcaagttttctatcttatacggaggaagcattaagagat
gtaaaacatcatattgtagaacttgccaataaagaagggctacatgcgcatgcgaaagca
attcaaataagatttggggaggaagaataa

DBGET integrated database retrieval system