KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1891Help
Entry
BT9727_1891       CDS       T00179                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00010  Glycolysis / Gluconeogenesis
btk00260  Glycine, serine and threonine metabolism
btk00680  Methane metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
btk01230  Biosynthesis of amino acids
Module
btk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btk_M00002  Glycolysis, core module involving three-carbon compounds
btk_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_1891
  Energy metabolism
   00680 Methane metabolism
    BT9727_1891
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT9727_1891
Enzymes [BR:btk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT9727_1891
Membrane trafficking [BR:btk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BT9727_1891
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT9727_1891
  Exosomal proteins of melanoma cells
   BT9727_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF5317
Motif
Other DBs
NCBI-GeneID: 2855397
NCBI-ProteinID: YP_036222
UniProt: Q6HJQ4
Position
1974283..1974873
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGREQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPVQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKKVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagagagcaggtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaactggtgaaacgttagcagagggaattgggtgtccagttcaattagaagaggaatta
atggagttcaataatggagtgcaagcaggcctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaaaggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system