KEGG   Bacillus thuringiensis 97-27: BT9727_1891Help
Entry
BT9727_1891       CDS       T00179                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT9727_1891
   01230 Biosynthesis of amino acids
    BT9727_1891
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_1891
  Energy metabolism
   00680 Methane metabolism
    BT9727_1891
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT9727_1891
Enzymes [BR:btk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT9727_1891
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT9727_1891
  Exosomal proteins of melanoma cells
   BT9727_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974283..1974873
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGREQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPVQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKKVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagagagcaggtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgtgctcgt
gaaactggtgaaacgttagcagagggaattgggtgtccagttcaattagaagaggaatta
atggagttcaataatggagtgcaagcaggcctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaaaggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system