KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_1950Help
Entry
BT9727_1950       CDS       T00179                                 

Gene name
bsaA
Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00480  Glutathione metabolism
btk00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BT9727_1950 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BT9727_1950 (bsaA)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BT9727_1950 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 2853862
NCBI-ProteinID: YP_036279
UniProt: Q6HJJ7
Position
2025018..2025500
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTIIGEEKSLKDYEGKVLLIVNVASKCGFTPQYKGLQEVYDKYKEQGLEILG
FPCNQFGGQEPGTEVDITSFCELNYGVNFPMFAKIDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgtatgatttttcagctaaaacaataataggtgaagaaaaatcgttaaaagat
tacgagggaaaagtacttcttattgtaaatgtagctagtaaatgcgggtttacaccgcaa
tataaaggattacaagaagtatatgataaatataaagaacaagggctagaaatactcggt
ttcccatgtaaccaattcggaggacaagaaccaggtacagaagtagatattacaagcttt
tgtgaattaaactacggtgtaaacttcccaatgtttgcaaaaattgatgtaaaaggtgat
aaggctcatcctctgtatacatacatgacagaacaagcaccaggtttactcggtatgaaa
gcagtaaaatggaactttacaaaatttctaattggaaaagacggaaaagtagtaggacgt
tttgcaccgcaaacgaagccggtggatttagaggttgagattgagaaggtacttggtgaa
taa

DBGET integrated database retrieval system