KEGG   Bacillus thuringiensis 97-27: BT9727_2212Help
Entry
BT9727_2212       CDS       T00179                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BT9727_2212 (hemY)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BT9727_2212 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2299680..2301080
Genome map
AA seq 466 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLEGEMVYNETGISYIYSDNTLHPIPSDTIFGIPMSARSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLSLFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIIDRLEEMLTETV
VKKGAVTTAVSKQGDCYEISFANHDSIHADYVVLAAPHDIAETLLQSNELNEQFHTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQTL
QEKMMNLYPNIYLAGASYYGVGIGACIGNGKNIANEIIATLNEPSN
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggttgttgttatcggtggaggtattacaggactttccactatgttttattta
gagaaattaaaaaaggattataatatcgatttaaatttaatccttgtagaaaaagaagag
tacttaggtggtaaaatccatagtgtagaagaaaaggattttattatggaatcaggagcg
gattctattgttgcacgtaatgaacatgttatgccacttgtaaaagatttaaatttagaa
ggagaaatggtatataacgagacgggtatttcttacatatattctgataatactttacat
ccaattccgtctgacactatatttgggataccgatgagtgcccgatcgttgtttagcagt
acgctagtatcaacgaaggggaaaattgttgctttaaaagattttataacgaaaaataaa
gagtttacaaaagatacatccctttccctatttttagaaagctttttagggaaagaatta
gtagaaagacaaattgcgccagtgctttcaggtgtatattctggtaaattgaacgagctt
acaatggcatctacattaccatatttactggactataaaaataaatatggaagtattatt
aaaggttttgaagagaataaaaaacagtttcaatcagcaggaaacaaaaagttcgtatca
tttaaaggtggattatctacgattattgatcgtttagaagaaatgctgactgagacggtt
gttaagaaaggtgctgtaacgacagctgtaagcaaacaaggtgattgctatgaaatctct
tttgcaaatcacgattcaatccacgctgattatgttgttttagcagctccgcatgatatc
gcagaaactttattacagtctaatgagttaaacgaacagtttcatacatttaaaaactca
tctcttataagtatttacttaggatttgacatactagatgaacaattaccggcggacggc
acaggatttatcgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagc
cggaagtggaaacatacatctggaaaacaaaaactattagtgagaatgttttataagagt
actaatccagtatatgaaacgattaaaaattatagtgaagaagaattagtacgggttgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtggttgaagtgaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggtccaaacatta
caagaaaaaatgatgaatctttacccgaatatatacttagctggcgcttcctattatggt
gttggtattggtgcgtgtattggaaatggaaaaaacattgcaaatgaaatcattgcaaca
ttaaatgaaccatcaaattaa

DBGET integrated database retrieval system