KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_2333Help
Entry
BT9727_2333       CDS       T00179                                 

Gene name
acs
Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00010  Glycolysis / Gluconeogenesis
btk00620  Pyruvate metabolism
btk00640  Propanoate metabolism
btk00680  Methane metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_2333 (acs)
   00620 Pyruvate metabolism
    BT9727_2333 (acs)
   00640 Propanoate metabolism
    BT9727_2333 (acs)
  Energy metabolism
   00680 Methane metabolism
    BT9727_2333 (acs)
Enzymes [BR:btk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BT9727_2333 (acs)
Lipid biosynthesis proteins [BR:btk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BT9727_2333 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 2857461
NCBI-ProteinID: YP_036659
UniProt: Q6HIG7
Position
2424785..2426725
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAVGYQWMKPY
TEVLDLQNGTPFAQWYNGGTCNVVESVLSRWLADDETRTQPALQYEGENGTSKSFTYEEL
DSWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFEMVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacacgcttatatggt
tggatgaaatcattggggtatgaagattatgaaacgttttataataaatctattgaagaa
acagcttggttttggggagaagctgagaaagcggttggctatcaatggatgaaaccttat
acagaagtgttagacttgcaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagtgttatcacgctggcttgcagatgatgaaacaagaacgcaa
ccagcacttcagtatgaaggagaaaatggaacttcaaaatcatttacatatgaagaactt
gatagctgggtaagtcgcgttgcaaatggtttgaaacatgcgggtattgaaaaaggcgac
cgagtaacaatttatatgccaatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggatttgcgtctgatgcagtcatgaca
cgcgtgcaagcagcaggatcaaagatgatcattactgcagatggtttttcacgccgaggt
aagattgtttcattaaaagatgaagtagataaagcttgtgagcattgtccaactgttgaa
aaagtcgttatcgtgcgccacgcaggaaatgattttacaccgcataattatgatttctca
tggagtacgttagaaaaagaaaagccatttgtacatgctgaagaaatgcatagtgacgat
ccgttaatgctcatttatacatcaggtacaacaggaaaaccgaaagggaccgtgcacact
catgctggtttccctttgaaagcagcatttgatgcagggtttgggatgaatataaaacaa
ggcgaccgcgtattatgggtaactgatatgggctggatgatgggaccatttttactattt
ggctctctcattaatggagcaacgatggttatgtatgaaggtgttccggacttcccagaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatctcggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgatgagtatgtaaataaacattcgcttaag
agtttagaagtatttgcctcaacaggcgagccttggaatccagacccttggatgtggcta
tttgaaatggttggaaaaagtaatgtgccaatttgtaactattcaggcggaactgaaatt
tcaggtgggattttcgggaacgtccttattaaaccaattgcaccgattagctttaatgct
tctttaccagggatggcggcggttgtgctcgatgatcaaggtaatccaattcgcgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagac
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcatggtgac
tgggtggtttatgatggtgagcaatatattattacaggacgctcagatgatacgctaaac
attgctggaaaacgcattggacctgctgaatatgaatctattcttgtgaagcataatgat
gtcatagaagctgccgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagataatgtaacatttacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcacgttgtagaagat
ttaccgaaaacgcgtaattctaaagtaatgcgacgtgtcattaaagctgcttatctaggg
aaagaattaggtgatttatcatcacttgtaaaccctgaagtagtgccatttattcaggga
ttgcagtctagtaaattataa

DBGET integrated database retrieval system