KEGG   Bacillus thuringiensis 97-27: BT9727_2367Help
Entry
BT9727_2367       CDS       T00179                                 

Gene name
adhB
Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BT9727_2367 (adhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_2367 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    BT9727_2367 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BT9727_2367 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BT9727_2367 (adhB)
   00626 Naphthalene degradation
    BT9727_2367 (adhB)
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BT9727_2367 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2456171..2456710
Genome map
AA seq 179 aa AA seqDB search
MKLNPRQDEKVLITGMGVIGLLACYFLKYYVGVKHVDVVEPNKNRRDFAKKFCAKNIYDS
EEQIIETYNYGFECSATNSGFHTLQKTLKINGQICILSDGNIEELTLTADFYQKELQIIG
SSDGYDYQKHADWFFSQIEQIPLLEEIFQHEIHYTALEQCFEALSKGTIHPLKVFVSYE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactaaacccgcgacaggatgaaaaggtacttataactggaatgggagttatcggt
ttacttgcttgttatttcttaaaatactatgtaggtgttaagcatgtagatgttgttgaa
cctaataaaaatagaagagattttgcaaagaagttttgtgcgaaaaacatatatgattca
gaagaacaaataatagaaacatataattacggtttcgaatgttctgctacaaatagcgga
tttcatacattacaaaaaacacttaaaattaatggacaaatatgtatactttctgatggt
aatattgaagaattaacattaaccgctgatttttatcagaaagaactgcaaattattggt
tcaagtgatgggtatgattatcaaaaacatgcagattggttttttagtcaaatagaacaa
ataccattgttagaagagatttttcaacatgaaattcattatactgcacttgaacaatgt
tttgaggcattgagcaaagggacaatacatccattaaaagtatttgtttcatatgaataa

DBGET integrated database retrieval system