KEGG   Bacillus thuringiensis 97-27: BT9727_2523Help
Entry
BT9727_2523       CDS       T00179                                 

Gene name
kynU
Definition
kynureninase (EC:3.7.1.3)
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BT9727_2523 (kynU)
Enzymes [BR:btk01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BT9727_2523 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2609334..2610620)
Genome map
AA seq 428 aa AA seqDB search
MYKEPFQPTYEYALECDKHDELKDFQTEFYKKEGTIYLDGNSLGLLSKRAEKSLLTLLDS
WKEYGIDGWTEGEHPWFFLSEKLGELTAPLIGALPEESIVTGSTTTNIHQVIATFYEPKG
IRTKILADELTFPSDIYALQSQIRLKGLDPDEHLVRVKSRDGRTLSEDDIIQAMTDDIAL
ILLPSVLYRSGQILDMKRLTAEAHERGIHIGFDLCHSIGSIPHHFKEWDVDFAIWCNYKY
LNAGPGGVAGLYVNKKHFNRLPGLSGWFSSRKDKQFDMEHTLTAADHAGAYQIGTPHILS
TAPLIGSLEIFKDAGIERLREKSLHITRYMLNLIDHELKDFGFAIGNPLEDEKRGGHIYL
EHAEAARICKALKANGVIPDFRAPNGVRLAPVALYNTYEEVWQSVMILKKIMKDEEYKQF
ENKREVVA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagaaccatttcaaccaacttatgagtatgcgcttgaatgtgataaacatgat
gaactgaaagattttcaaactgaattttataaaaaagaaggaacaatatatttagatgga
aactcattagggctactttcaaaaagagcagagaaatcgttacttacgttgctagattca
tggaaagagtatggcattgacggctggaccgagggtgagcatccgtggtttttcctttcg
gagaaattaggtgaattgactgcacctcttattggagctttaccagaagaaagcattgta
accggttccacgacaacgaatattcatcaagtaatcgcaactttctatgagccgaaagga
attcggacaaaaattcttgcggatgaattaacatttccatcagatatatatgcacttcaa
agtcaaattcgtttaaagggtctagatccagatgagcatttagtacgagtgaagagccga
gacggtagaacactttctgaagatgatattattcaagcaatgacagatgacatcgcgtta
attttattgccttctgtactatatagaagtggacaaattcttgatatgaaacgtttaaca
gcggaagctcatgagcgtggtattcatatcgggttcgatttatgtcactcaatcggttct
attccgcatcatttcaaagaatgggatgttgatttcgcgatttggtgtaattataaatac
ttaaacgcaggacctggcggtgttgctggcctttatgtaaataaaaagcattttaataga
cttcctggattatcaggttggtttagttctagaaaagataagcagtttgatatggaacat
acattaacagctgctgatcatgcaggtgcttatcaaattggtacaccgcacatattaagt
actgcacctttaattggttcacttgaaatatttaaagatgctggtatagaacgtttacgt
gaaaaatccttacatattacaagatacatgcttaatttgattgaccatgaattaaaagat
ttcggatttgcaattggaaatccattagaggatgaaaaacgaggcgggcatatttattta
gagcatgcagaagcagcacgtatatgtaaagcgttaaaagcaaatggagtaattccagat
tttagagcgccaaatggagtgagacttgcgcccgttgctttatataatacgtacgaagaa
gtatggcagtctgttatgattttaaagaaaattatgaaagatgaagagtataagcaattt
gaaaataagcgagaggttgtggcataa

DBGET integrated database retrieval system