KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_2731Help
Entry
BT9727_2731       CDS       T00179                                 

Gene name
proB
Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00330  Arginine and proline metabolism
btk00332  Carbapenem biosynthesis
btk01100  Metabolic pathways
btk01130  Biosynthesis of antibiotics
btk01230  Biosynthesis of amino acids
Module
btk_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BT9727_2731 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BT9727_2731 (proB)
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BT9727_2731 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 2857940
NCBI-ProteinID: YP_037055
UniProt: Q6HHC1
Position
complement(2804594..2805697)
Genome map
AA seq 367 aa AA seqDB search
MKKQRIVVKIGSSSLADSHEGISKEQLSDHVAALARLKEEGHEVLLITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATL
GELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQK
NEDAKKYYFLPEVTEEIASLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEK
FVDVLKGKGDGTYVGNAPQKEMKMNKQWIALHSVVSGQIEIDAGAATAIIQHGKSLLPAG
VTNVSGFFQVGEVVEVMTQQGRVIGKGQCTYSAEELRDVKGMQSQHIQARGERHSYEVIH
RDHWVSL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacgaattgttgtaaagattgggagcagttctttggcggatagtcacgaa
ggcatttctaaagaacaactttcagatcatgttgcggcattagctcgattgaaagaggaa
gggcatgaagttttgttaattacatctggggccgttgctgcaggtttttctgcgctagga
tatcctagcagacctgtaacaattaaaggaaaacaggcagctgcagctgtcggacaaagt
ttgttaatgcaggcgtacacggaggaattccgtaaatatggtatcgttactgcgcaacta
ttgctgacgagaagtgatttttctagaaaagaacaatatagtaacgcttacgctacttta
ggagagttactaaaccgttctgctcttccaatcattaatgaaaatgattccatttcttta
gaggagctaacgttcggtgataatgatatgctgtcagctttagtaagcggacttgtttcg
gcggatatgctgatgatttttacagatgtgaacggtttatatgataaaaatcctcagaaa
aatgaggatgcgaaaaaatattatttccttcctgaagttacagaagaaatcgcttctctt
gcaggagatgctggctcaaaacttgggactggcggaatgaaatcaaaaatcgatgctgca
aagacagcactctctcttggtgtgagtgtatttatcggaacaggacgtggacaagagaaa
tttgtagatgttttgaaggggaaaggtgatggaacgtatgtcggaaatgcccctcaaaaa
gaaatgaagatgaataagcaatggatcgctttgcattcggttgttagcggacaaattgaa
atagacgctggagcagctacagctatcattcagcatggcaagagtcttcttcctgctggt
gttacaaatgtttcagggtttttccaagtgggcgaagtcgtagaagtaatgacgcaacaa
ggacgcgtgattggaaaaggacaatgcacatatagtgcagaggagctaagggatgtaaaa
ggtatgcaaagccaacatattcaagcaagaggcgaaaggcatagttatgaagtcatccat
agagatcattgggtttcactttaa

DBGET integrated database retrieval system