KEGG   Bacillus thuringiensis 97-27: BT9727_2907Help
Entry
BT9727_2907       CDS       T00179                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:btk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:btk00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:btk00471]
Environmental Information Processing; Signal transduction; Two-component system [PATH:btk02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2980241..2981221)
Genome map
AA seq 326 aa AA seqDB search
MIKDSSVQVEGQEKVYLDQWVAHYRTYAAKGRSASYIPALGEINVSQLGICIVKPDGTMI
KAGDWEVPFTLQSISKVIGFIAACLSRGISYVLERVDVEPTGDAFNSIIRLEIHKPGKPF
NPMINAGAITIASLLPGTSVQEKLESIYVLIEKMIEKRPAINEIVFQSEWETAHRNRALA
YYLKENGFLESDVEETLEVYLKQCSIEINTEDIALIGLILAHDGYHPIRKEQVLPKEVAR
LTKALMLTCGMYNASGKFAAFIGLPAKSGVSGGIMTLVPSKSKKDVPFLDGCGIGIYGPA
IDEYGNSLPGIMLLEHIAKEWDLSIF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgataaaggattctagcgttcaagttgaggggcaagaaaaagtttacttagatcaatgg
gtagctcattatcgaacgtatgcagctaagggacgaagcgccagttatattcccgctctg
ggggaaataaatgtatcgcagctaggtatttgtatagtaaagccagatggaacaatgata
aaggcaggagattgggaggtacctttcacattacaaagtatatcaaaagtaattggtttt
atagctgcttgtttaagtcgcggtatttcttatgtattagaacgagttgatgtagaacca
actggagatgccttcaattcgattattcgtttagagatacataaaccaggaaaacctttt
aatcccatgatcaatgctggagcgattacgatagcttcacttttgccagggacatcggtg
caagaaaaattagaatctatatacgtattaattgagaaaatgatagagaagcgtcccgct
attaatgaaatagtatttcaatcagaatgggaaacggctcatcgtaacagagctttagca
tactatttaaaggagaatggttttctagaatcagatgtggaggagacactagaggtttac
ctaaaacaatgttcgattgaaataaatacagaagatattgccttaatcgggcttatacta
gcacatgatggatatcaccctattcgcaaagaacaagtactccctaaagaagtagctagg
ttaacaaaagctttaatgcttacttgtggaatgtacaacgcttctggaaaatttgctgct
ttcattgggttaccagctaaaagtggggtatccggcggaattatgacacttgttccctca
aagtctaagaaggatgtaccgttcctagatggatgtggtattggtatttacggaccagcc
attgatgaatatgggaatagtttaccaggaattatgttgttagaacatattgcaaaagaa
tgggatttaagtatattttaa

DBGET integrated database retrieval system