KEGG   Bacillus thuringiensis 97-27: BT9727_2951Help
Entry
BT9727_2951       CDS       T00179                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT9727_2951
   01230 Biosynthesis of amino acids
    BT9727_2951
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_2951
  Energy metabolism
   00680 Methane metabolism
    BT9727_2951
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT9727_2951
Enzymes [BR:btk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT9727_2951
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT9727_2951
  Exosomal proteins of melanoma cells
   BT9727_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3028470..3028817)
Genome map
AA seq 115 aa AA seqDB search
MCKEGLYNFGGIIEERMSDKELFPLIEKSFLDPDFALTGGESNVDWQKRAIKVLKELLNT
CRGQKVVVGTHGAVMTLMMGYYDSKYDLNFLLQTSKPDIYRMEFNGQELVEVKRL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtaaagagggattatacaactttggaggaattatcgaggaacgaatgtcagataaa
gaattatttcctttgatagaaaagtcatttttagaccccgattttgctttaacgggagga
gagtctaatgtcgactggcagaaacgtgctataaaagtcttaaaagaattattaaacacc
tgtcgaggacagaaagtagtagtaggcactcatggagctgttatgacgttgatgatgggg
tattatgacagtaagtatgatttgaattttttactacagacatcaaagccagatatatat
agaatggaattcaatggacaggaattggtggaggttaaaagattgtag

DBGET integrated database retrieval system