KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_3723Help
Entry
BT9727_3723       CDS       T00179                                 

Definition
(RefSeq) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
  KO
K05822  tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00300  Lysine biosynthesis
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01230  Biosynthesis of amino acids
Module
btk_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BT9727_3723
Enzymes [BR:btk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BT9727_3723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapH_N Hexapep Hexapep_2 Fucokinase Acetyltransf_11
Motif
Other DBs
NCBI-GeneID: 2854873
NCBI-ProteinID: YP_038042
UniProt: Q6HEI4
Position
complement(3819485..3820207)
Genome map
AA seq 240 aa AA seqDB search
MKMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVLFGEWSEIKTI
LDENSKYIVDYVVENDRRNSAIPMLDLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINI
GAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVV
LEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTEIKQELRQLNPEK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggacgctaacgaaattatttcgtttattcaaaaaagtgaaaagaaaact
cctgtaaaggtatacataaaaggggatttaaaagaagtaacattccctgaaacagtacaa
gcatttgtaaataaaaagtctggtgtattatttggagaatggtctgaaattaagacaatt
ctagatgaaaatagcaaatacattgttgattacgttgttgaaaatgaccgtcgtaattct
gcaattccaatgcttgatttaaaaggtattaaagctcgtattgagccaggtgcgattatt
cgtgaccacgttgaaatcggcgacaacgctgttattatgatgaatgcaacaattaacatc
ggtgctgtaattggtgaaggttctatgatcgacatgaacgcggtacttggtggacgtgca
actgttggtaagaactgtcacgtaggtgcaggtgcagtacttgcaggcgttattgagcca
ccttcagcaaaaccagttatcgttgaagacgatgttgtaattggtgctaacgtagttgtg
ttagagggagttacagtaggtaaaggtgcagttgtagcagcaggagctgttgtaacagaa
gatgtacctccatatacagttgttgcaggtactccagcacgtgtaattaaagaaattgat
gagaagacaaaagcaaaaactgaaattaaacaagagcttcgtcaattaaacccagagaaa
taa

DBGET integrated database retrieval system