KEGG   Bacillus thuringiensis 97-27: BT9727_3723Help
Entry
BT9727_3723       CDS       T00179                                 

Definition
tetrahydrodipicolinate N-succinyltransferase (EC:2.3.1.-)
Orthology
K05822  
tetrahydrodipicolinate N-acetyltransferase [EC:2.3.1.89]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BT9727_3723
  Amino acid metabolism
   00300 Lysine biosynthesis
    BT9727_3723
Enzymes [BR:btk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.89  tetrahydrodipicolinate N-acetyltransferase
     BT9727_3723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3819485..3820207)
Genome map
AA seq 240 aa AA seqDB search
MKMMDANEIISFIQKSEKKTPVKVYIKGDLKEVTFPETVQAFVNKKSGVLFGEWSEIKTI
LDENSKYIVDYVVENDRRNSAIPMLDLKGIKARIEPGAIIRDHVEIGDNAVIMMNATINI
GAVIGEGSMIDMNAVLGGRATVGKNCHVGAGAVLAGVIEPPSAKPVIVEDDVVIGANVVV
LEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTEIKQELRQLNPEK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgatggacgctaacgaaattatttcgtttattcaaaaaagtgaaaagaaaact
cctgtaaaggtatacataaaaggggatttaaaagaagtaacattccctgaaacagtacaa
gcatttgtaaataaaaagtctggtgtattatttggagaatggtctgaaattaagacaatt
ctagatgaaaatagcaaatacattgttgattacgttgttgaaaatgaccgtcgtaattct
gcaattccaatgcttgatttaaaaggtattaaagctcgtattgagccaggtgcgattatt
cgtgaccacgttgaaatcggcgacaacgctgttattatgatgaatgcaacaattaacatc
ggtgctgtaattggtgaaggttctatgatcgacatgaacgcggtacttggtggacgtgca
actgttggtaagaactgtcacgtaggtgcaggtgcagtacttgcaggcgttattgagcca
ccttcagcaaaaccagttatcgttgaagacgatgttgtaattggtgctaacgtagttgtg
ttagagggagttacagtaggtaaaggtgcagttgtagcagcaggagctgttgtaacagaa
gatgtacctccatatacagttgttgcaggtactccagcacgtgtaattaaagaaattgat
gagaagacaaaagcaaaaactgaaattaaacaagagcttcgtcaattaaacccagagaaa
taa

DBGET integrated database retrieval system