KEGG   Bacillus thuringiensis 97-27: BT9727_3773Help
Entry
BT9727_3773       CDS       T00179                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:btk00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:btk00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
3866709..3867485
Genome map
AA seq 258 aa AA seqDB search
MVTNRVVFLTGAASGIGYEMGNAFAKEGAKVVITDRLEGRAKEAAEQLQKEGFQAIGLKC
DVTSEEEIEASISQTVNHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAPFIAI
KHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGITVNA
LCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFLASEK
AKGITGQAVVIDGGYTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggttacaaatcgagttgtttttttaacaggtgctgcaagtggtattggatatgaaatg
ggaaacgcttttgcaaaagaaggtgcaaaagttgttattaccgatcgtcttgaaggacgt
gcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatcggcttaaaatgt
gatgttacatccgaagaagaaatagaagcatccatttcccaaactgttaatcatttcggt
tcattagacatattaattaataacgcaggaatgcaacacgtttcaccaattgaagatttt
ccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctccttttatcgcaatt
aagcatgccttccctattatgaaaaaacaaaaatatggccgtattataaatgtagcttcc
attaatggcctcgttggattcgctggaaaagctgcttataatagcgcaaaacatggcgta
attggattaacaaaagttgccgctttagaaggggctactcacggaattactgttaatgca
ctttgtcccggttatgtcgatacccctctcgtacggaatcaattacaagacttggccact
acacgaaatgtaccacttgaaaatgttttagaggatgtcatttatccacttgtaccacaa
aaacgcttattacaagtacaagagattgctgattatgcgatgtttttagcgagcgaaaaa
gctaaaggtataactggacaagctgtcgttatcgatggtggttataccgctcaataa

DBGET integrated database retrieval system