KEGG   Bacillus thuringiensis 97-27: BT9727_4004Help
Entry
BT9727_4004       CDS       T00179                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT9727_4004 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_4004 (glcK)
   00052 Galactose metabolism
    BT9727_4004 (glcK)
   00500 Starch and sucrose metabolism
    BT9727_4004 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BT9727_4004 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BT9727_4004 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BT9727_4004 (glcK)
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BT9727_4004 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4068400..4069383)
Genome map
AA seq 327 aa AA seqDB search
MEEKWLVGVDLGGTTIKLAFINVYGEILHKWEIPTNTNEQGKHITLDVAKAIDKKLEELG
ELKSKLIGIGMGAPGPVHVASGMIYEAVNLGWKNYPLKDLLEVETGLPVVIDNDANLAAL
GEMWKGAGEGAKDLICMTLGTGVGGGVIANGEIVHGVSGAAGEIGHITVVTENAFPCNCG
KSGCLETVASATGIVRVAMQKIQETDKESILRSMLAEEGRITSKDVFEAHGQGDELAGEV
VEKVASYLGLAVANLSSTLNPEKIVIGGGVSKAGDALLEPIQRYFEQYAFSRAVKSTKLA
IATLGNDAGVIGGAWLVKKHKYEAKMI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaaatggttagttggtgttgaccttggtggtacaacgattaaattagcattt
attaatgtgtacggtgaaattttacataagtgggaaatccctacgaatacaaatgagcaa
ggaaaacatattacacttgatgtagcgaaagctattgataaaaagttagaagagttaggt
gaattaaaaagtaagttaattggtattggtatgggagctcctggccctgtacacgtggcg
tctggaatgatttatgaagcggttaacttaggatggaaaaactatccgttaaaagattta
ttagaagtagaaacaggattacctgttgttattgataatgatgcaaatttagcggcactt
ggtgaaatgtggaagggtgctggtgaaggagcaaaagatttaatttgtatgacacttggc
actggtgttggcggcggtgtgattgccaatggtgagattgtacatggcgtaagcggtgct
gctggtgagattggacacattacagtcgttacagagaatgctttcccgtgtaattgcggg
aagtctggttgcctagaaactgtagcatctgcaacaggtattgtacgtgttgctatgcag
aaaatacaagagactgataaagaaagtattctacgttctatgttagcagaagaagggcgt
attacatcaaaagacgtatttgaagcacatggacaaggtgatgaactagcaggcgaagta
gtagaaaaggtagcttcttatttaggattagctgtagcgaacctttcgagcacgttgaac
ccagagaaaatcgttattggtggaggcgtttctaaagctggagatgcactattagaacca
attcaacgttatttcgagcaatacgctttctcacgtgctgtaaagagcacgaagttagct
attgcaacacttggtaatgatgcaggtgttatcggaggagcttggcttgtaaaaaagcac
aaatacgaagcgaagatgatataa

DBGET integrated database retrieval system