KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4104Help
Entry
BT9727_4104       CDS       T00179                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00010  Glycolysis / Gluconeogenesis
btk00071  Fatty acid degradation
btk00350  Tyrosine metabolism
btk00620  Pyruvate metabolism
btk00625  Chloroalkane and chloroalkene degradation
btk00626  Naphthalene degradation
btk00650  Butanoate metabolism
btk01100  Metabolic pathways
btk01110  Biosynthesis of secondary metabolites
btk01120  Microbial metabolism in diverse environments
btk01130  Biosynthesis of antibiotics
btk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_4104
   00620 Pyruvate metabolism
    BT9727_4104
   00650 Butanoate metabolism
    BT9727_4104
  Lipid metabolism
   00071 Fatty acid degradation
    BT9727_4104
  Amino acid metabolism
   00350 Tyrosine metabolism
    BT9727_4104
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BT9727_4104
   00626 Naphthalene degradation
    BT9727_4104
Enzymes [BR:btk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BT9727_4104
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BT9727_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 RapA_C
Motif
Other DBs
NCBI-GeneID: 2857572
NCBI-ProteinID: YP_038422
UniProt: Q6HDF4
Position
complement(4165610..4168213)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDTLVNNGRKALQALESFTQEQIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKKDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQNCSIAAAKTVYDAAVKAGAPKHCVQWIE
KPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIANDCYFVTEEERRKLEKLVINENT
CAVNSDIVGKSAQYIAELVGITVPKNTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSVNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVAHYLRKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FQPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGSKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVITVPPHVTADTGMDV
LTHAIEAYVSVLANDYTDGLALKAIDLVFKYLPRAFKDGHDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSAAEGVESLVKAIIDLGKSLNINMSIAGQGVAKDQFEEVVGLLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaggaagtaaaagagatgattgatacg
ttagtgaataacggtcggaaggctttacaagcattagaaagttttacacaagagcaaatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccacttgcgaaa
ttggctgttgaagaaacaggtcgtggtgtatacgaagataaatgcattaaaaatattttt
gctactgaatatatttggcatagcataaagaaagataaaacagtagggattattcacgaa
gatcctcatgaagaaataatagaaattgcggagcccgtcggtgtagtagctggggtaaca
ccagtaacaaatccaacatcgacaacaatgtttaaagcattaatcgcgataaaaacgaga
aatccaattattttcgcatttcatccttcagcacaaaactgttctattgcagccgcgaaa
acagtatacgatgcagcggtgaaggcgggggcaccaaaacattgtgtgcagtggattgaa
aagccttctgtcgaagcaacgaaacaattaatgaaccatgaaggtgttgcgcttgttttg
gcaactggaggggctggtatggtgaaatcagcttattctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccatgttatatagagaaatcagcgcatataaaacgagcggtt
aatgatttgattttatcaaaaacatttgataacgggatgatttgtgcatcagaacaagca
attattgtagataaggaaatttatgatgatgtgaaaacagaaatgattgcaaatgattgt
tactttgtaacagaggaagagagaagaaaattagaaaagcttgttattaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatccgcacagtatattgccgaattagttgga
attactgtacctaaaaatacaaaaatgcttgtagctgaaatacaaggcatcggagccgca
tatccactatcacgtgagaagttaagtccagtattagcttgtgtaaaagcaaattcatta
gaagaaggatttacatattgtgaagaaatgttaaacctcggtggtttagggcattcagca
gttatccattctgtaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgt
cgccttattgtaaatgctccttcatcacaaggtggaatcggtgacatatataatggattt
attccatcacttacgcttggctgcggttcctacgggaaaaactcggtttctcaaaacgta
acagcgacgcatttattaaatataaaaaggttggcaaatagaaaaaagaatatgcagtgg
ttcaaattaccaccaaaaatttattttgaaaaacatgcgacagcatatttagcaaatatg
cctaacatttcacgtgcgtttattgtaacggatccaggaatggttgagcacggatatgta
gatacggtcgctcattatttacgtaaacatgcaaatgatgtgaaagtagaagttttcttt
gaggttgagccagatccatcagatgaaactgtgtttaaaggtgcggaaatgatgagaagt
tttcagcctgacgtcattatcgcacttggtggtggttcagcgatggatgcagcgaaaggg
atgtggcttttctatgagcatccagaaacaacattctatggaattaaacagaagttttta
gatataagaaaacgcacatgtaaatatccggaattaggaagtaaggcgcagtttgttgcc
attccaacaacatctggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtacccactcgcggattatgaattaacgccagatgtagcaattgta
gatccgcaatttgtaataacagtaccgccacatgtaacagcagacactgggatggacgta
ttaacgcatgcaatcgaggcgtatgtgtctgttttagcaaatgactatacagatggacta
gcattaaaggctattgatctcgtatttaaatatttaccaagagcatttaaagatggacat
gatgaagaagcacgagaaaaaatgcataatgcttctgcaattgcagggatggcatttgca
aatgcattcctaggtattaatcacagtttagcgcataaaattggaccagaattccatatt
ccgcatggacgtgcgaatgccattcttatgccgcacgtaattcgttataatgctattaag
ccaagaaaacatgcattgttcccaaaatatgagcactttgtggctgatgaacgctatgca
catattgcgagaatgctcgggcttccagcaagttcggcggcagaaggtgtggaatcactc
gtcaaagcaattattgatctcggaaaaagtttaaatataaatatgagtattgcgggacaa
ggagttgctaaagaccaatttgaagaggttgttggattattagcagaaagagcttttgaa
gatcaatgtacaacagctaatccgaaattacctctcatttcagagctgaaagaaatttat
atgaaagcatataaaggtgagtaa

DBGET integrated database retrieval system