KEGG   Bacillus thuringiensis 97-27: BT9727_4259Help
Entry
BT9727_4259       CDS       T00179                                 

Gene name
phaB
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:btk01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btk00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4321411..4322187)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataacattcgtgttgttgttattcacggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacgactcgtgctgtactagagttattgcaaacaacgaaatcgtctcattat
tatgaaggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtcgcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system