KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_4492Help
Entry
BT9727_4492       CDS       T00179                                 

Definition
(RefSeq) lysophospholipase L2
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BT9727_4492
Enzymes [BR:btk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BT9727_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 DUF676 LCAT Ser_hydrolase PGAP1 Abhydrolase_3 LIDHydrolase Abhydrolase_5 DUF900 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 2856111
NCBI-ProteinID: YP_038804
UniProt: Q6HCC2
Position
complement(4546011..4546814)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEMAHKKINDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtaatcgttattgtacacggcgcaatg
gaatatcacgggcgttatgaagccgttgcggaaatgtggaatcatatcggctaccacgtt
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtataggttg
cctatctttttatttggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaaaagagaagatgtagatggcattattttaagttcgccatgtttaggcgtattagct
ggaccttctgcaccgctgcaagctgcctcaaaaatattaaatattattgctccaaaattg
caatttgcaacgaatcttacagtggaaatgtcaactcgtaatcatgaagtgagagatgcg
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaatggctcataagaaaataaacgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgcgacgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system