KEGG   Bacillus thuringiensis 97-27: BT9727_4492Help
Entry
BT9727_4492       CDS       T00179                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:btk00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4546011..4546814)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEMAHKKINDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtaatcgttattgtacacggcgcaatg
gaatatcacgggcgttatgaagccgttgcggaaatgtggaatcatatcggctaccacgtt
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtataggttg
cctatctttttatttggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaaaagagaagatgtagatggcattattttaagttcgccatgtttaggcgtattagct
ggaccttctgcaccgctgcaagctgcctcaaaaatattaaatattattgctccaaaattg
caatttgcaacgaatcttacagtggaaatgtcaactcgtaatcatgaagtgagagatgcg
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaatggctcataagaaaataaacgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgcgacgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system