KEGG   Bacillus thuringiensis 97-27: BT9727_4492Help
Entry
BT9727_4492       CDS       T00179                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BT9727_4492
Enzymes [BR:btk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BT9727_4492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4546011..4546814)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEMAHKKINDFPDVPLLLMQACEDKLVDKTRVRTWFDNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagcggaggaagcaaaggctgtaatcgttattgtacacggcgcaatg
gaatatcacgggcgttatgaagccgttgcggaaatgtggaatcatatcggctaccacgtt
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattca
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtataggttg
cctatctttttatttggtcatagtatgggtggtcttatcgtcattcgtatgatgcaagaa
acgaaaagagaagatgtagatggcattattttaagttcgccatgtttaggcgtattagct
ggaccttctgcaccgctgcaagctgcctcaaaaatattaaatattattgctccaaaattg
caatttgcaacgaatcttacagtggaaatgtcaactcgtaatcatgaagtgagagatgcg
atggagaatgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctatcgaaatggctcataagaaaataaacgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttgataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgcgacgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system