KEGG   Bacillus thuringiensis 97-27: BT9727_4809Help
Entry
BT9727_4809       CDS       T00179                                 

Gene name
est
Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
btk  Bacillus thuringiensis 97-27
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4860516..4861259)
Genome map
AA seq 247 aa AA seqDB search
MMKLASPKPFTFEGGDRAVLLLHGFTGNSADVRMLGRFLEKKGYTCHAPIYKGHGVPPEE
LVHTGPEDWWQDVTEAYQLLKDKGFEKIAVVGLSLGGVFSLKLGYTVPVLGVVPMCAPMY
IKSEETMYQGILAYAREYKKREQKSPEQIEQEMLEFKKTPMNTLKALQQLIADVRNNVDM
IYAPTFVVQARHDEMINTDSANIIYNGVESTLKDIKWYEDSTHVITLDKQRDELHEDVYN
FLEQLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattagcatctccgaaaccatttacatttgagggtggagaccgcgctgtttta
ttactacatggattcacaggaaactcagctgatgtacgtatgttagggcgtttcttagaa
aagaaaggctacacttgtcatgcgccaatttataaagggcacggtgtaccaccagaagag
cttgttcatacaggtcctgaagattggtggcaagatgtaacggaagcatatcagctttta
aaagataaagggtttgagaaaattgctgtcgttggattgtcacttggcggagttttttca
ctaaaattaggttatacagtaccggttttaggtgtagtaccaatgtgtgcaccaatgtat
attaagagtgaagaaacgatgtaccaaggtatattggcatatgcccgcgaatataaaaag
cgtgagcaaaaatcaccagagcaaatcgaacaagaaatgttggaattcaaaaagacaccg
atgaatacattaaaagcattacaacaattaattgctgacgtacgtaacaatgtggacatg
atttatgcgccaacatttgttgtacaagcacgtcatgatgaaatgattaatacagatagt
gcgaacattatttataacggtgtagaatcaacgttaaaagacattaaatggtatgaagac
tctacgcatgtcattacacttgataagcagcgtgacgagctacatgaggatgtatataac
ttcttggagcaactagattggtaa

DBGET integrated database retrieval system