KEGG   Bacillus thuringiensis 97-27: BT9727_4816Help
Entry
BT9727_4816       CDS       T00179                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
btk  Bacillus thuringiensis 97-27
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT9727_4816 (tpiA)
   01230 Biosynthesis of amino acids
    BT9727_4816 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT9727_4816 (tpiA)
   00051 Fructose and mannose metabolism
    BT9727_4816 (tpiA)
   00562 Inositol phosphate metabolism
    BT9727_4816 (tpiA)
Enzymes [BR:btk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BT9727_4816 (tpiA)
Exosome [BR:btk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BT9727_4816 (tpiA)
  Exosomal proteins of bladder cancer cells
   BT9727_4816 (tpiA)
  Exosomal proteins of melanoma cells
   BT9727_4816 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4867082..4867837)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTLSEAVSFVEEVKGQIPAASAVDAVVCSPALFLERLVAATEGTDLQ
VGAQNMHFEKNGAFTGEISPVALSDLKVGYVVLGHSERREMFAETDESVNKKTIAAFEHG
LTPIVCCGETLEERESGKTFDLVAGQVTKALAGLTEEQVKATVIAYEPIWAIGTGKSSSS
ADANEVCAHIRKVVAEAVSPEAAEAVRIQYGGSVKPENIKEYMAQSDIDGALVGGASLEP
ASFLGLLGAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattatcgcaggtaactggaaaatgaataaaactctatctgaagcagtt
agcttcgtagaggaagttaaaggtcaaatcccagcagcttcagctgttgatgcagtagtt
tgctctccagctctattcttagagcgccttgtagcagcgactgaaggaactgatttacaa
gtaggtgcacaaaacatgcacttcgaaaaaaatggtgcattcactggcgaaattagccca
gtagcacttagcgacttaaaagtaggctacgtagtacttggccactctgagcgtcgtgaa
atgtttgctgaaacagatgagtcagtaaacaaaaagactattgcagcatttgaacatggt
ttaacaccaatcgtatgttgtggtgagactttagaagagcgcgaaagcggaaaaacattt
gatctagtagcaggtcaagtgacaaaagcacttgcaggtttaacagaagagcaagttaaa
gcaactgttatcgcttatgagccaatctgggctatcggtacaggtaaatcttcttcttct
gcagatgcaaacgaagtatgtgcgcacatccgtaaagttgttgcagaagctgtttctcca
gaagctgcagaagctgttcgtattcaatacggcggtagcgtaaaaccagaaaacattaaa
gagtacatggcacaatctgacatcgacggcgctttagttggcggtgctagcttagagcct
gcttcgttcttaggtcttctgggggcggtaaaatga

DBGET integrated database retrieval system