KEGG   Bacillus thuringiensis serovar konkukian 97-27: BT9727_5014Help
Entry
BT9727_5014       CDS       T00179                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
btk  Bacillus thuringiensis serovar konkukian 97-27
Pathway
btk00240  Pyrimidine metabolism
btk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BT9727_5014 (tdk)
Enzymes [BR:btk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BT9727_5014 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase DZR zf-C4_ClpX
Motif
Other DBs
NCBI-GeneID: 2858656
NCBI-ProteinID: YP_039323
UniProt: Q6HAV3
Position
complement(5063447..5064034)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTNKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgtgcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttgaacatatcactgaa
gaaatggatgtaattgcaattgatgaagtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagcagtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccgattattttagttggggcttcagaatcgtatgaa
ccacgctgtcgtcattgtcatgcagttcctacaaacaaagataagtaa

DBGET integrated database retrieval system