KEGG   Bacillus thuringiensis Al Hakam: BALH_0040Help
Entry
BALH_0040         CDS       T00429                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
btl00900  Terpenoid backbone biosynthesis
btl01100  Metabolic pathways
btl01110  Biosynthesis of secondary metabolites
btl01130  Biosynthesis of antibiotics
Module
btl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BALH_0040 (ispE)
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BALH_0040 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABK83460
UniProt: A0R8B7
Position
48101..48979
Genome map
AA seq 292 aa AA seqDB search
MNRLKLLVKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHN
RYVPDDQRNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLW
NLGLTIDQLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVST
ADVYGNLKLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKR
FGADAVLMSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagattgaagctactagtgaaagcaccagcaaagattaatctgtcgttagatgta
ctgggaaaaagacaagacggatatcatgaagtgaaaatgattatgacaacaatcgattta
gcggatcgtttagaactaatggaattagcagaagaccgtattgaaattttatcccataat
cggtatgtcccagacgaccaaagaaatctggcttatcaagcagcgaaattattaaaagag
aagtttaatgtgaaaaaaggtgtatctattactattgaaaaaacgattccagtagcagct
ggattagcgggtggaagtagtgatgcagcagcgacattacgtggtcttaataaattatgg
aatttaggccttacgattgatcaattagcagagcttggcgcagaaattggatcagatgta
tcgttttgtgtatatggtgggacagcaattgccactggaagaggagagcagattgagcac
ataaaaactccaccttcttgttgggttattttagcaaagcctcatattggtgtatctact
gctgatgtatatggaaatttaaagttaaatcgagttacacatccaaatgtagataaaatg
gtggatgtcataaacgctggagactacaaagggatttgcgatactgttggtaacgtttta
gaagatgtaacgtttgctatgcatcctgaagttgcacgtattaaagcacaaatgaagcga
tttggagcagatgctgtattaatgagtggaagtggtccaactgtattcggcctagtgcac
catgattcgcgaatgcatcgtatatataacggattaaaaggattttgtgaacaagtatac
gcagtacgtttattaggagagcgagaaacgcttgaataa

DBGET integrated database retrieval system