KEGG   Bacillus thuringiensis Al Hakam: BALH_0175Help
Entry
BALH_0175         CDS       T00429                                 

Definition
alcohol dehydrogenase, zinc containing (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BALH_0175
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_0175
  Lipid metabolism
   00071 Fatty acid degradation
    BALH_0175
  Amino acid metabolism
   00350 Tyrosine metabolism
    BALH_0175
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BALH_0175
   00626 Naphthalene degradation
    BALH_0175
Enzymes [BR:btl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BALH_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(184312..185280)
Genome map
AA seq 322 aa AA seqDB search
MFNEDLKYDVNNDNSFQEDIMKAIICTQYGPPNVLQLQNIEKPIPKKNEVLVKIHATSVS
TGDCRIRGFNSPLLFWIPMRLILGLRKPRNPILGVELAGEIEDIGTDVTQFKKGDQIFAL
TELNLGGYAEYTCVHESGLITLKPTNVTYEEAAVIPFGGTSALHFLRKGRIKKGQQVLIY
GASGSVGTAAIQLAKYFGATVTAVCSNSNFELVQSLGADKVIDYTKEDFTKRRERYDIIF
DAVGKYKKSLCKQVLAPNGKYVSVNGMMAKVSKEDMILLKELTETEHLKPVIDRTYRLEE
IAEAHMYVEIGHKKGNVSITLK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatgaagatcttaaatatgatgtaaataacgacaactcatttcaggaggacatt
atgaaggcgatcatttgcacacagtatggaccacctaacgttcttcagcttcaaaatata
gagaaacctatccctaaaaagaatgaagtattagttaagattcacgcaacaagtgtatcg
actggagattgtagaatacgcggatttaatagccctctattattttggattcctatgcga
cttatattaggacttagaaaaccgagaaaccctatacttggcgtagaattagcaggagag
atagaggatatcgggacagatgtaactcaatttaaaaaaggggatcaaatttttgcatta
acagaactcaatcttggtggttatgccgaatacacatgcgtgcatgaaagtggattaata
acattaaaacctaccaatgtaacgtatgaagaagcggcagttattccttttggtggaact
tcagcgttgcattttctgagaaaaggccggataaaaaaggggcaacaagttctcatatat
ggtgcctctggatcagtaggaacagctgccatacaactcgctaaatattttggtgcgacc
gttacagctgtttgtagtaattcaaattttgaactcgtgcaatctttaggagcggataaa
gtaattgattatacgaaagaagattttactaagcggcgcgagcgttacgatattatattt
gatgcagttgggaagtataaaaaatccctttgtaaacaagtattagcgcctaatggaaaa
tatgtatctgtgaatggaatgatggcaaaagtaagtaaagaggatatgattctactaaaa
gaactaactgaaacagaacatttaaaacctgttattgatagaacttaccgattagaagaa
attgctgaagctcatatgtatgtggaaatagggcataaaaaagggaacgtttctattacc
ttaaaataa

DBGET integrated database retrieval system