KEGG   Bacillus thuringiensis Al Hakam: BALH_0398Help
Entry
BALH_0398         CDS       T00429                                 

Definition
ROK family protein (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
btl  Bacillus thuringiensis Al Hakam
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:btl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BALH_0398
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BALH_0398
   00052 Galactose metabolism
    BALH_0398
   00500 Starch and sucrose metabolism
    BALH_0398
   00520 Amino sugar and nucleotide sugar metabolism
    BALH_0398
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BALH_0398
   00524 Butirosin and neomycin biosynthesis
    BALH_0398
Enzymes [BR:btl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BALH_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455968..456846
Genome map
AA seq 292 aa AA seqDB search
MKEYIAFDIGGTQIKYGIVSETGIVLKHKAVPTEIHLGGGQIIQKLILLSKKLMSEHTIS
GIGISTAGIVDVNRGVVTGGADHIPGYSTIPIINRLQEVLKVPVSIENDVNCAALGEKWN
GIGREKENFIMLTLGTGIGGAIFIDRELYRGHSYSAGEWGNMLIEGKTFEEVASISGLIH
LVRNYKGKGNWNGKTIFELYDKGDREVTQAVEVFFKHLAIGISNLAYIFNPETIIIGGGI
TDRGNQFLKEVKEEVGRYLNKEIYSDCEIELAQNGNRAGMIGAIYHFLHHHK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatatattgcatttgatattggtggtacacaaattaaatatggaattgtttca
gaaacaggaatagtactaaaacacaaagcagttccaacagaaattcatttgggcggggga
caaattattcaaaaactcattcttttatcaaaaaaattaatgagtgaacatacgatttcg
ggaattggtattagtactgcgggaattgttgacgttaatagaggggttgtgacgggaggg
gcggatcatattccgggctatagtacgattcctattattaatagattgcaagaggtatta
aaagttcccgtatctattgaaaatgatgtgaattgtgctgcgctgggagaaaagtggaat
ggtattggaagagagaaagaaaatttcattatgctcacccttggaactggtattggagga
gcgatttttatagatagagagttatatagagggcattcatatagtgctggtgaatgggga
aacatgttaatagaaggaaaaacgtttgaagaggtcgcttccatttcagggttaattcat
cttgtacgaaattataaaggaaaaggtaattggaatgggaaaacgattttcgaactgtat
gataaaggcgacagggaagttacgcaagcagttgaggttttctttaaacatttagcgatt
ggaattagtaaccttgcttatatttttaatccagaaacaattattattggtggaggaatt
actgatagaggaaatcagtttttaaaagaagtaaaagaagaggtaggaagatacttaaat
aaagagatttatagtgattgtgagattgaacttgcgcaaaacggtaatcgtgcaggaatg
attggtgctatttaccacttcttacatcatcataagtaa

DBGET integrated database retrieval system